Antibodies

Jump to Filters
View as table Download
Fibrillarin (FBL) Rabbit Polyclonal Antibody
TA345779

USD 410.00

5 Days

Rabbit Polyclonal Anti-FBL Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FBL antibody: synthetic peptide directed towards the N terminal of human FBL. Synthetic peptide located within the following region: GGGFHSGGNRGRGRGGKRGNQSGKNVMVEPHRHEGVFICRGKEDALVTKN
Fibrillarin (FBL) Rabbit Polyclonal Antibody
TA326942

USD 275.00

3 Weeks

FBL Rabbit Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Monkey, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human FBL