Rabbit anti-HSP90AB1 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Monkey |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human HSP90AB1 |
Rabbit anti-HSP90AB1 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Monkey |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human HSP90AB1 |
Rabbit anti-NFKBIB Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human NFKBIB |
Rabbit polyclonal HSP90B (Ab-254) antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human HSP90B around the phosphorylation site of serine 254 (V-G-SP-D-E). |
Rabbit polyclonal HSP90B (Ser254) antibody(Phospho-specific)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human HSP90B around the phosphorylation site of serine 254 (V-G-SP-D-E). |
Modifications | Phospho-specific |
Rabbit polyclonal IkB-beta (Ser23) antibody(Phospho-specific)
Applications | IF, IHC, WB |
Reactivities | Human: Ser23, Mouse: Ser23, Rat: Ser23 |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human I?B-β around the phosphorylation site of serine 23. |
Modifications | Phospho-specific |
Rabbit polyclonal HSP90AB1 Antibody (C-term)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This HSP90AB1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 697-724 amino acids from the C-terminal region of human HSP90AB1. |
Rabbit polyclonal HSP90AB1 Antibody (Center)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This HSP90AB1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 438-465 amino acids from the Central region of human HSP90AB1. |
Rabbit Polyclonal HSP90 beta Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Primate |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to a C-terminal portion of the human Hsp90B protein (between residues 650-724) [UniProt P08238] |
HSP90AB1 (250-325) rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rabbit, Rat |
Immunogen | Synthetic peptide between aa 250-325 in the sequence of human Hsp90 |
Rabbit Polyclonal Anti-NFKBIB Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-NFKBIB Antibody: synthetic peptide directed towards the C terminal of human NFKBIB. Synthetic peptide located within the following region: MLRPNPILARLLRAHGAPEPEGEDEKSGPCSSSSDSDSGDEGDEYDDIVV |
Rabbit Polyclonal HSP90 beta Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an N-terminal portion of the human Hsp90B protein (between residues 1-50) [UniProt P08238] |
Anti-NFKBIB (Phospho-Ser23) Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around phosphorylation site of serine 23 (L-G-S(p)-L-G) derived from Human I?B-β. |
Modifications | Phospho-specific |