Antibodies

Jump to Filters
View as table Download
Arginase 1 (ARG1) Rabbit Polyclonal Antibody
TA308162

USD 415.00

In Stock

Rabbit Polyclonal antibody to Arginase I (arginase, liver)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 322 of Arginase I (Uniprot ID#P05089)
Arginase 1 (ARG1) (1-145) Rabbit Polyclonal Antibody
AP23580PU-N

USD 440.00

2 Weeks

Arginase 1 (ARG1) (1-145) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen Recombinant protein fragment containing a sequence corresponding to a region within amino acids 1 and 145 of Human Arginase-1
Arginase 1 (ARG1) Rabbit Polyclonal Antibody
TA338396

USD 310.00

5 Days

Rabbit Polyclonal Anti-ARG1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ARG1 antibody: synthetic peptide directed towards the N terminal of human ARG1. Synthetic peptide located within the following region: HSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLK
Arginase 1 (ARG1) Rabbit Polyclonal Antibody
TA338397

USD 310.00

5 Days

Rabbit Polyclonal Anti-ARG1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ARG1 antibody: synthetic peptide directed towards the C terminal of human ARG1. Synthetic peptide located within the following region: LDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPK