Antibodies

View as table Download

Rabbit anti-FTH1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human FTH1

Rabbit Polyclonal Anti-FTH1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FTH1 antibody: synthetic peptide directed towards the middle region of human FTH1. Synthetic peptide located within the following region: NVNQSLLELHKLATDKNDPHLCDFIETHYLNEQVKAIKELGDHVTNLRKM

Anti-FTH1 Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

Anti-FTH1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein