Antibodies

Jump to Filters
View as table Download
Superoxide Dismutase 1 (SOD1) Rabbit Polyclonal Antibody
TA326813

USD 275.00

3 Weeks

Rabbit anti-SOD1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human SOD1
Superoxide Dismutase 1 (SOD1) Rabbit Polyclonal Antibody
AP22845PU-N

USD 540.00

2 Weeks

Superoxide Dismutase 1 (SOD1) rabbit polyclonal antibody, Purified

Applications IHC, IP, WB
Reactivities Equine, Guinea Pig, Human, Mouse, Rat
Immunogen Synthetic peptide surrounding amino acid 131 of Human SOD
Superoxide Dismutase 1 (SOD1) Rabbit Polyclonal Antibody
TA338376

USD 310.00

5 Days

Rabbit Polyclonal Anti-SOD1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SOD1 antibody: synthetic peptide directed towards the N terminal of human SOD1. Synthetic peptide located within the following region: MATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHE