Superoxide Dismutase 1 (SOD1) Rabbit Polyclonal Antibody

CAT#: TA338376

Rabbit Polyclonal Anti-SOD1 Antibody

Product Images

Lanes: Lane 1: 50ug HeLa lysate; Lane 2: 50ug 293T lysate; Lane 3: 50ug K562 lysate; Lane 4: 50ug MDA-MB-231 lysate; Primary Antibody Dilution: 1: 500; Secondary Antibody: Anti-rabbit-HRP; Secondary Antibody Dilution: 1: 1000; Gene Name: SOD1; Submitted b

• 

  WB Suggested Antibody Titration: 2.5 ug/ml; Positive Control: Jurkat.SOD1 is supported by BioGPS gene expression data to be expressed in Jurkat

• 

  Human kidney

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SOD1 antibody: synthetic peptide directed towards the N terminal of human SOD1. Synthetic peptide located within the following region: MATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 16 kDa
• Gene Name: superoxide dismutase 1, soluble
• Database Link:
  NP_000445
  Entrez Gene 6647 Human
  UniProt ID P00441
• Background: The protein encoded by this gene binds copper and zinc ions and is one of two isozymes responsible for destroying free superoxide radicals in the body. The encoded isozyme is a soluble cytoplasmic protein, acting as a homodimer to convert naturally-occuring but harmful superoxide radicals to molecular oxygen and hydrogen peroxide. The other isozyme is a mitochondrial protein. Mutations in this gene have been implicated as causes of familial amyotrophic lateral sclerosis. Rare transcript variants have been reported for this gene. [provided by RefSeq, Jul 2008]
• Synonyms: ALS; ALS1; HEL-S-44; homodimer; hSod1; IPOA; SOD
• Note: Immunogen Sequence Homology: Human: 100%; Yeast: 100%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Amyotrophic lateral sclerosis (ALS), Huntington's disease, Prion diseases