Antibodies

View as table Download

Rabbit Polyclonal antibody to GAPDH (glyceraldehyde-3-phosphate dehydrogenase)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 335 of GAPDH (Uniprot ID#P04406)

Rabbit Polyclonal Anti-TUBE1 Antibody - middle region

Applications IHC, WB
Reactivities Drosophila, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TUBE1 antibody: synthetic peptide directed towards the middle region of human TUBE1. Synthetic peptide located within the following region: HLHHYLQVEGMEESCFTEAVSSLSALIQEYDQLDATKNMPVQDLPRLSIA

Rabbit polyclonal ATP6V1B1 Antibody (Center)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ATP6V1B1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 284-310 amino acids from the Central region of human ATP6V1B1.

Rabbit Polyclonal antibody to alpha Tubulin 1A (tubulin, alpha 1a)

Applications IF, IHC, WB
Reactivities Human, Mouse, Drosophila, Rat
Conjugation Unconjugated
Immunogen Recombinant protein fragment contain a sequence corresponding to a region within amino acids 37 and 276 of alpha Tubulin 1A

Rabbit Polyclonal Calnexin Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Bovine, Chicken, Avian, Drosophila
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal region of the canine Calnexin protein (within residues 25-100). [Swiss-Prot P24643]

Rabbit Polyclonal anti-UBB Antibody

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Hamster, Rabbit, Guinea Porcine, Bovine, Porcine, Dog, Sheep, Chicken, Xenopus, Drosophila
Conjugation Unconjugated
Immunogen Native bovine Ubiquitin, conjugated to KLH

Rabbit Polyclonal Antibody against CDC2 (T14)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CDK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from human CDK1.

Rabbit Polyclonal anti-CANX Antibody

Applications IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Bovine, Chicken, Dog, Guinea Porcine, Hamster, Porcine, Quail, Rabbit, Sheep, Drosophila, Xenopus
Conjugation Unconjugated
Immunogen Dog calnexin C-terminal synthetic peptide conjugated to KLH. Identical to human, mouse and rat calnexin sequences over these residues.

Rabbit Polyclonal TRPM8 Antibody

Applications IHC, WB
Reactivities Drosophila, Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptides made to residues 278-292 RNQLEKYISERTIQD and the C-terminus sequence NDLKGLLKEIANKIK of the human trp-p8 protein.