Antibodies

View as table Download

Rabbit anti-HNRNPK Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human HNRNPK

Rabbit Polyclonal Anti-HNRPK Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HNRPK antibody: synthetic peptide directed towards the C terminal of human HNRPK. Synthetic peptide located within the following region: YSYAGGRGSYGDLGGPIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGAS

Rabbit Polyclonal Anti-HNRPK Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HNRPK antibody: synthetic peptide directed towards the N terminal of human HNRPK. Synthetic peptide located within the following region: NTETNGEFGKRPAEDMEEEQAFKRSRNTDEMVELRILLQSKNAGAVIGKG

hnRNP K Rabbit polyclonal Antibody

Applications IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human hnRNP K