Antibodies

View as table Download

Rabbit polyclonal antibody to RICTOR

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 1648 and 1708 of RICTOR (Uniprot ID#Q6R327)

Rabbit Polyclonal Anti-RICTOR Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human RICTOR

RICTOR Antibody

Applications IHC
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the following sequence GENDLKFTKNFGTENHRENTSRERLVVESSTSSHMKIRSQSFNTDTTTSG

RICTOR rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human RICTOR

Rictor (Phospho-Thr1135) polyclonal antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic phosphopeptide derived from human Rictor around the phosphorylation site of Threonine 1135.