Antibodies

View as table Download

Rabbit polyclonal anti-GluR6 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human GluR6.

Rabbit Polyclonal Anti-GRM6 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GRM6 antibody: synthetic peptide directed towards the N terminal of human GRM6. Synthetic peptide located within the following region: AGGLTLGGLFPVHARGAAGRACGQLKKEQGVHRLEAMLYALDRVNADPEL

Rabbit Polyclonal Anti-mGluR6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-mGluR6 Antibody: A synthesized peptide derived from human mGluR6

Rabbit Polyclonal Anti-GRM6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GRM6 antibody: synthetic peptide directed towards the middle region of human GRM6. Synthetic peptide located within the following region: EFWEENFNCKLTSSGTQSDDSTRKCTGEERIGRDSTYEQEGKVQFVIDAV

Rabbit Polyclonal Anti-GRM6 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GRM6 antibody: synthetic peptide directed towards the C terminal of human GRM6. Synthetic peptide located within the following region: ITFSLTSLQVVGMIAWLGARPPHSVIDYEEQRTVDPEQARGVLKCDMSDL