Antibodies

Jump to Filters
View as table Download
Orexin Receptor 1 (HCRTR1) (C-term) Rabbit Polyclonal Antibody
AP23376PU-N

USD 405.00

2 Weeks

Orexin Receptor 1 (HCRTR1) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to a sequence at the C-terminal of human Orexin Receptor
Orexin Receptor 1 (HCRTR1) Rabbit Polyclonal Antibody
TA311891

USD 345.00

In Stock

Rabbit polyclonal anti-HCRTR1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human HCRTR1.
Orexin Receptor 1 (HCRTR1) Rabbit Polyclonal Antibody
TA338269

USD 375.00

5 Days

Rabbit Polyclonal Anti-HCRTR1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HCRTR1 antibody is: synthetic peptide directed towards the N-terminal region of Human HCRTR1. Synthetic peptide located within the following region: ATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYEWVLIAAYV