Rabbit Polyclonal anti-HSPA5 Antibody
Applications | WB |
Reactivities | Hamster, Human, Monkey, Mouse, Rabbit, Rat, Xenopus, Fungus, Cow |
Conjugation | Unconjugated |
Immunogen | Rat GRP78 (Bip) sythetic peptide conjugated to KLH |
Rabbit Polyclonal anti-HSPA5 Antibody
Applications | WB |
Reactivities | Hamster, Human, Monkey, Mouse, Rabbit, Rat, Xenopus, Fungus, Cow |
Conjugation | Unconjugated |
Immunogen | Rat GRP78 (Bip) sythetic peptide conjugated to KLH |
Rabbit Polyclonal Antibody against MAP2K1 (S217)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This MEK1(MAP2K1) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 196-225 amino acids from human MEK1(MAP2K1). |
Rabbit Polyclonal anti-HSPA5 Antibody
Applications | IF, WB |
Reactivities | Hamster, Human, Monkey, Mouse, Rabbit, Rat, Xenopus, Fungus, Cow |
Conjugation | Unconjugated |
Immunogen | Rat GRP78 (Bip) sythetic peptide (amino acids 645-654, C-terminus) conjugated to KLH. Identical to mouse and hamster GRP78 sequenes over residues EEDTSEKDEL. |
Rabbit polyclonal MAPK1 Antibody (Center)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This MAPK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 154-183 amino acids from the Central region of human MAPK1. |
Rabbit polyclonal SOD (Cu/Zn) Antibody
Applications | IF, WB |
Reactivities | Bovine, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Sheep, Xenopus, Dog, Pig, Coral |
Conjugation | Unconjugated |
Immunogen | Human Cu/Zn SOD |
Rabbit Polyclonal Antibody against HSPA1A (Y41)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This HSPA1A/HSPA1B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 19-48 amino acids from human HSPA1A/HSPA1B. |
Rabbit Polyclonal Anti-Egr1 Antibody
Applications | IHC, WB |
Reactivities | Mouse, Xenopus |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Egr1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: PATTSFPSPVPTSYSSPGSSTYPSPAHSGFPSPSVATTFASVPPAFPTQV |