Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Antibody against ATG5
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Porcine, Primate, Xenopus, Zebrafish, Cow, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an N-terminal region (within residues 1-50) of the human ATG5 protein. [Swiss-Prot# Q9H1Y0] |
Rabbit polyclonal antibody to HN1 (hematological and neurological expressed 1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 166 of HN1 (Uniprot ID#Q9UK76 isoform2) |
Rabbit Polyclonal Antibody against SAT1
| Applications | WB |
| Reactivities | Human, Mouse, Porcine, Xenopus, Hamster, Cow, Rat, Chicken |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a C-terminal region within residues 100-171 of the human protein. [Swiss-Prot# P21673] |
Rabbit Polyclonal antibody to LETM1 (leucine zipper-EF-hand containing transmembrane protein 1)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 506 and 723 of LETM1 (Uniprot ID#O95202) |
Rabbit Polyclonal antibody to PNPase (polyribonucleotide nucleotidyltransferase 1)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 25 and 251 of PNPase (Uniprot ID#Q8TCS8) |
Rabbit Polyclonal antibody to UQCRFS1 (ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1)
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 274 of UQCRFS1 (Uniprot ID#P47985) |
Rabbit Polyclonal Antibody against VEGFA
| Applications | WB |
| Reactivities | Human, Mouse, Dog, Horse, Cow, Rat, Chicken, Guinea Pig |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal region of the human VEGFA protein sequence (between residues 150-250). [Swiss-Prot# P15692] |
Rabbit Polyclonal Antibody against LOX
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Porcine, Cow |
| Conjugation | Unconjugated |
| Immunogen | A cocktail of two synthetic peptides; one made to a region of the human LOX protein within residues 300-400 and one within residues 200-300 |
Rabbit Polyclonal Anti-Claudin 5 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Pig, Cow |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Claudin 5 Antibody: A synthesized peptide derived from human Claudin 5 |
Rabbit Polyclonal Anti-Claudin 11 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Cow |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Claudin 11 Antibody: A synthesized peptide derived from human Claudin 11 |
Rabbit Polyclonal antibody to CD98 (solute carrier family 3 (activators of dibasic and neutral amino acid transport), member 2)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 89 and 433 of CD98 (Uniprot ID#P08195) |
Rabbit Polyclonal antibody to PUF60 (poly-U binding splicing factor 60KDa)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 346 and 523 of PUF60 (Uniprot ID#Q9UHX1) |
Rabbit Polyclonal Anti-TRAK1 Antibody
| Applications | WB |
| Reactivities | Human, Rabbit, Rat, Dog, Pig, Horse, Cow |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRAK1 antibody: synthetic peptide directed towards the middle region of human TRAK1. Synthetic peptide located within the following region: ILETEAADLGNDERSKKPGTPGTPGSHDLETALRRLSLRRENYLSERRFF |
Rabbit Polyclonal antibody to LIMCH1 (LIM and calponin homology domains 1)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 734 and 1007 of LIMCH1 (Uniprot ID#Q9UPQ0) |
Rabbit polyclonal antibody to Calsequestrin-2 (calsequestrin 2 (cardiac muscle))
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 124 and 388 of Calsequestrin 2 (Uniprot ID#O14958) |
Rabbit polyclonal antibody to DNAJB6 (DnaJ (Hsp40) homolog, subfamily B, member 6)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 116 of DNAJB6 (Uniprot ID#O75190) |
Rabbit polyclonal antibody to Peripherin (peripherin)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 215 of Peripherin (Uniprot ID#P41219) |
Rabbit Polyclonal Anti-FAM86A Antibody
| Applications | WB |
| Reactivities | Guinea Pig, Human, Rat, Dog, Horse, Cow |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-FAM86A Antibody is: synthetic peptide directed towards the C-terminal region of Human FAM86A. Synthetic peptide located within the following region: CREHQRAPEVYVAFTVRNPETCQLFTTELGRAGIRWEVEPRHEQKLFPYE |
Rabbit polyclonal antibody to Interleukin-17 receptor C (interleukin 17 receptor C)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 62 and 471 of Human Interleukin-17 receptor C |
Rabbit polyclonal antibody to MPI (mannose phosphate isomerase)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 154 of MPI (Uniprot ID#P34949) |
Rabbit polyclonal antibody to zinc finger protein 574 (zinc finger protein 574)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 162 and 358 of ZNF574 (Uniprot ID#Q6ZN55) |
Rabbit Polyclonal antibody to Dyrk3 (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 3)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 243 and 532 of Dyrk3 (Uniprot ID#O43781) |
Active filters
Reactivities
- Cow
Applications
- WB
Antibody Hosts
- Rabbit
Isotypes
- IgG
Conjugates
- Unconjugated
Filter by
Category
Target Symbol
- ACTC1 (1)
- ATG5 (1)
- CASQ2 (1)
- CLDN11 (1)
- CLDN5 (1)
- DNAJB6 (1)
- DYRK3 (1)
- EEF2KMT (1)
- GK5 (1)
- GSTA4 (1)
- IL17RC (1)
- JPT1 (1)
- KRT10 (1)
- KRT13 (1)
- LETM1 (1)
- LIMCH1 (1)
- LOX (1)
- MPI (1)
- MPP1 (1)
- NOTCH1 (1)
- NSUN6 (1)
- PDSS2 (1)
- PNPT1 (1)
- PRPH (1)
- PUF60 (1)
- RANBP1 (1)
- RGS13 (1)
- RPA3 (1)
- SAT1 (1)
- SGSH (1)
- SLC25A33 (1)
- SLC3A2 (1)
- TRAK1 (1)
- TUBG1 (1)
- UQCRFS1 (1)
- VEGFA (1)
- ZNF346 (1)
- ZNF574 (1)
Clonalities
Families
Pathways
- Metabolic pathways (4)
- Cardiac muscle contraction (2)
- Cell adhesion molecules (CAMs) (2)
- Leukocyte transendothelial migration (2)
- Tight junction (2)
- Alzheimer's disease (1)
- Amino sugar and nucleotide sugar metabolism (1)
- Amyotrophic lateral sclerosis (ALS) (1)
- Arginine and proline metabolism (1)
- Bladder cancer (1)
- Cytokine-cytokine receptor interaction (1)
- DNA replication (1)
- Dilated cardiomyopathy (1)
- Dorso-ventral axis formation (1)
- Drug metabolism - cytochrome P450 (1)
- Focal adhesion (1)
- Fructose and mannose metabolism (1)
- Glutathione metabolism (1)
- Glycosaminoglycan degradation (1)
- Homologous recombination (1)
- Huntington's disease (1)
- Hypertrophic cardiomyopathy (HCM) (1)
- Lysosome (1)
- Metabolism of xenobiotics by cytochrome P450 (1)
- Mismatch repair (1)
- Notch signaling pathway (1)
- Nucleotide excision repair (1)
- Oxidative phosphorylation (1)
- Pancreatic cancer (1)
- Parkinson's disease (1)
- Pathways in cancer (1)
- Prion diseases (1)
- Purine metabolism (1)
- Pyrimidine metabolism (1)
- RIG-I-like receptor signaling pathway (1)
- RNA degradation (1)
- Regulation of autophagy (1)
- Renal cell carcinoma (1)
- Spliceosome (1)
- Terpenoid backbone biosynthesis (1)
- VEGF signaling pathway (1)
- mTOR signaling pathway (1)