Rabbit Monoclonal Antibody against NOTCH1 (Clone EP1238Y)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Cow |
Conjugation | Unconjugated |
Rabbit Monoclonal Antibody against NOTCH1 (Clone EP1238Y)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Cow |
Conjugation | Unconjugated |
Rabbit Polyclonal Antibody against ATG5
Applications | IHC, WB |
Reactivities | Human, Mouse, Porcine, Primate, Xenopus, Zebrafish, Cow, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an N-terminal region (within residues 1-50) of the human ATG5 protein. [Swiss-Prot# Q9H1Y0] |
Rabbit polyclonal antibody to HN1 (hematological and neurological expressed 1)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 166 of HN1 (Uniprot ID#Q9UK76 isoform2) |
Rabbit Polyclonal antibody to SLC25A33 (solute carrier family 25, member 33)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 114 and 321 of SLC25A33 (Uniprot ID#Q9BSK2) |
Rabbit Polyclonal Antibody against SAT1
Applications | WB |
Reactivities | Human, Mouse, Porcine, Xenopus, Hamster, Cow, Rat, Chicken |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to a C-terminal region within residues 100-171 of the human protein. [Swiss-Prot# P21673] |
Rabbit monoclonal antibody against Actin (Pan)(EP184E)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Cow |
Conjugation | Unconjugated |
Rabbit Polyclonal antibody to LETM1 (leucine zipper-EF-hand containing transmembrane protein 1)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 506 and 723 of LETM1 (Uniprot ID#O95202) |
Rabbit Polyclonal antibody to Cytokeratin 10 (keratin 10)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 73 and 284 of Cytokeratin 10 |
Rabbit polyclonal antibody to SGSH (N-sulfoglucosamine sulfohydrolase)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 318 and 496 of SGSH (Uniprot ID#P51688) |
Rabbit Polyclonal antibody to PNPase (polyribonucleotide nucleotidyltransferase 1)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 25 and 251 of PNPase (Uniprot ID#Q8TCS8) |
Rabbit Polyclonal antibody to UQCRFS1 (ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1)
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 274 of UQCRFS1 (Uniprot ID#P47985) |
Rabbit Polyclonal Antibody against VEGFA
Applications | WB |
Reactivities | Human, Mouse, Dog, Horse, Cow, Rat, Chicken, Guinea Pig |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal region of the human VEGFA protein sequence (between residues 150-250). [Swiss-Prot# P15692] |
Rabbit Polyclonal Antibody against LOX
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Porcine, Cow |
Conjugation | Unconjugated |
Immunogen | A cocktail of two synthetic peptides; one made to a region of the human LOX protein within residues 300-400 and one within residues 200-300 |
Rabbit Polyclonal Anti-Claudin 5 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat, Pig, Cow |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Claudin 5 Antibody: A synthesized peptide derived from human Claudin 5 |
Rabbit Polyclonal Anti-Claudin 11 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat, Cow |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Claudin 11 Antibody: A synthesized peptide derived from human Claudin 11 |
Rabbit Polyclonal antibody to CD98 (solute carrier family 3 (activators of dibasic and neutral amino acid transport), member 2)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 89 and 433 of CD98 (Uniprot ID#P08195) |
Rabbit Polyclonal antibody to PUF60 (poly-U binding splicing factor 60KDa)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 346 and 523 of PUF60 (Uniprot ID#Q9UHX1) |
Rabbit polyclonal antibody to RGS13 (regulator of G-protein signaling 13)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 159 of RGS13 (Uniprot ID#O14921) |
Rabbit Polyclonal antibody to Ran BP1 (RAN binding protein 1)
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 201 of Ran BP1 (Uniprot ID#P43487) |
Rabbit polyclonal antibody to Cytokeratin 13 (keratin 13)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 198 and 438 of Cytokeratin 13 |
Rabbit polyclonal antibody to RPA 14 kDa subunit (replication protein A3, 14kDa)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 121 of RPA14 (Uniprot ID#P35244) |
Rabbit Polyclonal Anti-TRAK1 Antibody
Applications | WB |
Reactivities | Human, Rabbit, Rat, Dog, Pig, Horse, Cow |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TRAK1 antibody: synthetic peptide directed towards the middle region of human TRAK1. Synthetic peptide located within the following region: ILETEAADLGNDERSKKPGTPGTPGSHDLETALRRLSLRRENYLSERRFF |
Rabbit Polyclonal antibody to GSTA4 (glutathione S-transferase alpha 4)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 222 of GSTA4 (Uniprot ID#O15217) |
Rabbit Polyclonal antibody to LIMCH1 (LIM and calponin homology domains 1)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 734 and 1007 of LIMCH1 (Uniprot ID#Q9UPQ0) |
Rabbit polyclonal antibody to MPP1 (membrane protein, palmitoylated 1, 55kDa)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 304 of MPP1 (Uniprot ID#Q00013) |
Rabbit Polyclonal antibody to GK5 (glycerol kinase 5 (putative))
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 9 and 297 of GK5 |
Rabbit polyclonal antibody to ZNF346 (zinc finger protein 346)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 294 of ZNF346 (Uniprot ID#Q9UL40) |
Rabbit polyclonal antibody to Calsequestrin-2 (calsequestrin 2 (cardiac muscle))
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 124 and 388 of Calsequestrin 2 (Uniprot ID#O14958) |
Rabbit polyclonal antibody to DNAJB6 (DnaJ (Hsp40) homolog, subfamily B, member 6)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 116 of DNAJB6 (Uniprot ID#O75190) |
Rabbit polyclonal antibody to Peripherin (peripherin)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 215 of Peripherin (Uniprot ID#P41219) |
Rabbit polyclonal antibody to NSUN6 (NOL1/NOP2/Sun domain family, member 6)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 179 and 469 of NSUN6 (Uniprot ID#Q8TEA1) |
Rabbit Polyclonal Anti-FAM86A Antibody
Applications | WB |
Reactivities | Guinea Pig, Human, Rat, Dog, Horse, Cow |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-FAM86A Antibody is: synthetic peptide directed towards the C-terminal region of Human FAM86A. Synthetic peptide located within the following region: CREHQRAPEVYVAFTVRNPETCQLFTTELGRAGIRWEVEPRHEQKLFPYE |
Rabbit Polyclonal antibody to PDSS2 (prenyl (decaprenyl) diphosphate synthase, subunit 2)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 88 and 351 of PDSS2 (Uniprot ID#Q86YH6) |
Rabbit polyclonal antibody to Interleukin-17 receptor C (interleukin 17 receptor C)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 62 and 471 of Human Interleukin-17 receptor C |
Rabbit polyclonal antibody to MPI (mannose phosphate isomerase)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 154 of MPI (Uniprot ID#P34949) |
Rabbit polyclonal antibody to zinc finger protein 574 (zinc finger protein 574)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 162 and 358 of ZNF574 (Uniprot ID#Q6ZN55) |
Rabbit Polyclonal antibody to Dyrk3 (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 3)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 243 and 532 of Dyrk3 (Uniprot ID#O43781) |
gamma Tubulin Rabbit polyclonal Antibody
Applications | FC, IF, IHC, IP, WB |
Reactivities | Chicken, Fish, Hamster, Human, Monkey, Mouse, Rat, Xenopus, Dog, Cow |
Conjugation | Unconjugated |
Immunogen | A synthesized peptide derived from human Tubulin gamma |