Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal antibody to PRKACA (protein kinase, cAMP-dependent, catalytic, alpha)
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 351 of PKA C alpha (Uniprot ID#P17612) |
Rabbit polyclonal PKA alpha/beta CAT (Thr197) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PKA a/β CAT around the phosphorylation site of threonine 197 (T-W-TP-L-C). |
| Modifications | Phospho-specific |
Rabbit anti-PRKCB Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PRKCB |
Rabbit Polyclonal Anti-PRKACA Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRKACA antibody: synthetic peptide directed towards the N terminal of human PRKACA. Synthetic peptide located within the following region: MASNSSDVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRV |
Rabbit Polyclonal Anti-KAPC A/B Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KAPC A/B Antibody: A synthesized peptide derived from human KAPC A/B |
Rabbit polyclonal PKC a (Ab-657) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PKC a around the phosphorylation site of tyrosine 657 (F-S-YP-V-N). |
Rabbit polyclonal anti-PRKCG antibody
| Applications | WB |
| Reactivities | Human Mouse Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PRKCG. |
Rabbit polyclonal PKA CAT (Ab-197) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PKA CAT around the phosphorylation site of threonine197 (T-W-TP-L-C). |
Rabbit polyclonal anti-KAPC A/B antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human KAPC A/B. |
Rabbit polyclonal anti-KAPCB antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human KAPCB. |
Anti-PRKCB (Phospho-Thr641) Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of threonine 641 (E-L-T(p)-P-T) derived from Human PKCβ |
| Modifications | Phospho-specific |
Rabbit polyclonal PRKCG (Ab-655) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PRKCG around the phosphorylation site of threonine 655 (A-L-TP-P-P). |
Rabbit Polyclonal Phospho-PKCB (Ser661) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PKCB around the phosphorylation site of Serine 661 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Phospho-PKC alpha (Thr638) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PKC alpha around the phosphorylation site of Threonine 638 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Phospho-PKC-pan (Thr497) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PKC-pan around the phosphorylation site of Threonine 497 |
| Modifications | Phospho-specific |
Rabbit Polyclonal PKCB Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PKCB |
Rabbit Polyclonal PKC alpha Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PKC alpha |
Rabbit Polyclonal PKC-pan Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PKC-pan |
Rabbit polyclonal Anti-PRKCG Antibody
| Applications | Assay, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRKCG antibody: synthetic peptide directed towards the N terminal of human PRKCG. Synthetic peptide located within the following region: FVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRLHSYSSPTFCDHCGSL |
Rabbit Polyclonal Antibody against PRKCB1 (C-term)
| Applications | IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This PKC beta2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 642-673 amino acids from the C-terminal region of human PKC beta2. |
Rabbit polyclonal PKC a (Tyr657) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PKC a around the phosphorylation site of tyrosine 657 (F-S-YP-V-N). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-PKC beta antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to the C-terminus of mouse PKC β1 |
Rabbit Polyclonal Anti-PRKACB Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRKACB antibody: synthetic peptide directed towards the middle region of human PRKACB. Synthetic peptide located within the following region: NGVSDIKTHKWFATTDWIAIYQRKVEAPFIPKFRGSGDTSNFDDYEEEDI |
Rabbit Polyclonal Anti-PRKACB Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRKACB antibody: synthetic peptide directed towards the N terminal of human PRKACB. Synthetic peptide located within the following region: MGNAATAKKGSEVESVKEFLAKAKEDFLKKWENPTQNNAGLEDFERKKTL |
Anti-PRKCA rabbit polyclonal antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 339-597 amino acids of human protein kinase C, alpha |
Rabbit Polyclonal Anti-PRKCB Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human PRKCB |
Rabbit Polyclonal Anti-PRKCG Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human PRKCG |
Active filters
Category
-
Antibodies
- Primary Antibodies
Reactivities
- Mouse
Applications
- WB
Antibody Hosts
- Rabbit
Families
- Protein Kinase
Pathways
- Vibrio cholerae infection