Antibodies

View as table Download

Rabbit anti-GNAO1 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human GNAO1

Rabbit Polyclonal Anti-GNAO1 Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-GNAO1 Antibody: synthetic peptide directed towards the N terminal of human GNAO1. Synthetic peptide located within the following region: PVVYSNTIQSLAAIVRAMDTLGIEYGDKERKADAKMVCDVVSRMEDTEPF