Antibodies

View as table Download

Rabbit Polyclonal Anti-ANXA4 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ANXA4

Rabbit Polyclonal Anti-ANXA4 Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-ANXA4 antibody: synthetic peptide directed towards the N terminal of human ANXA4. Synthetic peptide located within the following region: GLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGNFEQ

Rabbit anti Annexin IV Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the N-terminus of human Annexin IV. This sequence is identical to human, mouse and rat.

ANXA4 rabbit polyclonal antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ANXA4

Annexin A4/Annexin IV Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 112-321 of human Annexin A4/Annexin IV (NP_001144.1).
Modifications Unmodified