Antibodies

Jump to Filters
View as table Download
APJ Receptor (APLNR) Rabbit Polyclonal Antibody
TA308705

USD 415.00

2 Weeks

Rabbit Polyclonal antibody to Apelin Receptor (apelin receptor)

Applications IF, IHC, WB
Reactivities Human
Immunogen Synthetic peptide corresponding to a region within amino acids 2 and 96 of Apelin Receptor (Uniprot ID#P35414)
APJ Receptor (APLNR) Rabbit Polyclonal Antibody
TA308706

USD 415.00

In Stock

Rabbit Polyclonal antibody to Apelin Receptor (apelin receptor)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 284 and 376 of Apelin Receptor (Uniprot ID#P35414)
APJ Receptor (APLNR) Rabbit Polyclonal Antibody
TA312186

USD 345.00

4 Weeks

Rabbit polyclonal anti-AGTRL1 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human AGTRL1.
APJ Receptor (APLNR) Rabbit Polyclonal Antibody
TA342806

USD 375.00

5 Days

Rabbit Polyclonal Anti-APLNR Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-APLNR antibody: synthetic peptide directed towards the N terminal of human APLNR. Synthetic peptide located within the following region: NGLVLWTVFRSSREKRRSADIFIASLAVADLTFVVTLPLWATYTYRDYDW
APJ Receptor (APLNR) Rabbit Polyclonal Antibody
TA321681

USD 345.00

In Stock

Anti-APLNR Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 272-380 amino acids of human apelin receptor
Aplnr Rabbit Polyclonal Antibody
TA357652

USD 390.00

5 Days

Aplnr Antibody - C-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated