Rabbit Polyclonal GPVI Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | GPVI antibody was raised against a 15 amino acid peptide near the carboxy terminus of the human GPVI. |
Rabbit Polyclonal GPVI Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | GPVI antibody was raised against a 15 amino acid peptide near the carboxy terminus of the human GPVI. |
Rabbit Polyclonal GPVI Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | GPVI antibody was raised against a 18 amino acid synthetic peptide near the center of the human GPVI. The immunogen is located within amino acids 130 - 180 of GPVI. |
Rabbit Polyclonal Anti-GP6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GP6 antibody: synthetic peptide directed towards the middle region of human GP6. Synthetic peptide located within the following region: PPSPVAEFSEATAELTVSFTNEVFTTETSRSITASPKESDSPAGPARQYY |
GP6 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human GP6 |
GP6 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human GP6 (NP_057447.4). |
Modifications | Unmodified |