Rabbit Polyclonal Grik5 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Grik5 antibody was raised against a 17 amino acid peptide near the carboxy terminus of the human Grik5. |
Rabbit Polyclonal Grik5 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Grik5 antibody was raised against a 17 amino acid peptide near the carboxy terminus of the human Grik5. |
GRIK5 (C-term) rabbit polyclonal antibody, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | GRIK5 antibody was raised against 17 amino acid peptide near the carboxy terminus of the human Grik5 |
Rabbit polyclonal Anti-GRIK5 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GRIK5 antibody: synthetic peptide directed towards the middle region of human GRIK5. Synthetic peptide located within the following region: EDGLYGAPEPNGSWTGMVGELINRKADLAVAAFTITAEREKVIDFSKPFM |
Grik5 Antibody - N-terminal region
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
GRIK5 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 350-420 of human GRIK5 (NP_002079.3). |
Modifications | Unmodified |