Antibodies

View as table Download

Rabbit anti-HIF1AN Polyclonal Antibody

Applications ICC/IF, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human HIF1AN

Rabbit Polyclonal Antibody against Factor Inhibiting HIF-1

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen A C-terminal region synthetic peptide made to the human FIH protein sequence (between residues 300 and the C-terminus).

Rabbit Polyclonal Anti-HIF1AN Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HIF1AN antibody: synthetic peptide directed towards the N terminal of human HIF1AN. Synthetic peptide located within the following region: MAATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDP

Rabbit Polyclonal Anti-HIF1AN Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-HIF1AN antibody: synthetic peptide directed towards the middle region of human HIF1AN. Synthetic peptide located within the following region: GGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEV

Rabbit Polyclonal Anti-HIF1AN Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-HIF1AN Antibody: synthetic peptide directed towards the N terminal of human HIF1AN. Synthetic peptide located within the following region: EAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTN

Rabbit Polyclonal Anti-HIF1AN Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-HIF1AN Antibody: synthetic peptide directed towards the middle region of human HIF1AN. Synthetic peptide located within the following region: TSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPV

Rabbit Polyclonal Anti-HIF1AN Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human HIF1AN

Rabbit Polyclonal Anti-HIF1AN Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human HIF1AN

HIF1AN rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Full length fusion protein