Antibodies

View as table Download

Rabbit Polyclonal Anti-PLSCR1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PLSCR1 antibody: synthetic peptide directed towards the N terminal of human PLSCR1. Synthetic peptide located within the following region: MDKQNSQMNASHPETNLPVGYPPQYPPTAFQGPPGYSGYPGPQVSYPPPP

Rabbit Polyclonal Anti-PLSCR1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PLSCR1 antibody: synthetic peptide directed towards the N terminal of human PLSCR1. Synthetic peptide located within the following region: MDKQNSQMNASHPETNLPVGYPPQYPPTAFQGPPGYSGYPGPQVSYPPPP

Rabbit Polyclonal antibody to Scramblase1 (phospholipid scramblase 1)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 286 of Scramblase1 (Uniprot ID#O15162)

Rabbit Polyclonal Anti-PLSCR1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PLSCR1 Antibody is: synthetic peptide directed towards the middle region of Human PLSCR1. Synthetic peptide located within the following region: TGFETNNKYEIKNSFGQRVYFAAEDTDCCTRNCCGPSRPFTLRIIDNMGQ

Phospholipid Scramblase 1 (PLSCR1) Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-318 of human Phospholipid Scramblase 1 (Phospholipid Scramblase 1 (PLSCR1)) (NP_066928.1).
Modifications Unmodified