Rabbit Polyclonal Anti-PMF1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PMF1 antibody: synthetic peptide directed towards the N terminal of human PMF1. Synthetic peptide located within the following region: MVDTFLQKLVAAGSYQRFTDCYKCFYQLQPAMTQRIYDKFIAQLQTSIRE |
Rabbit Polyclonal Anti-PMF1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Immunogen | The immunogen for Anti-PMF1 Antibody: synthetic peptide directed towards the middle region of human PMF1. Synthetic peptide located within the following region: TDCYKCFYQLQPAMTQQIYDKFIAQLQTSIREEISDIKEEGNLEAVLNAL |
Rabbit Polyclonal anti-PMF1 antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | The immunogen for anti-PMF1 antibody: synthetic peptide directed towards the middle region of human PMF1. Synthetic peptide located within the following region: AAGSYQRFTDCYKCFYQLQPAMTQQIYDKFIAQLQTSIREEISDIKEEGN |
PMF1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-205 of human PMF1 (NP_009152.2). |
Germany
Japan
United Kingdom
China
