Germany
Japan
United Kingdom
China
USD 428.00
In Stock
Antibodies
Download
USD 180.00
In Stock
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR102D11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR094F2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal tdTomato Antibody
| Applications | WB |
| Immunogen | tdTomato |
Rabbit Polyclonal mCherry Antibody
| Applications | WB |
| Immunogen | mCherry |
Rabbit Polyclonal turboGFP Antibody
| Applications | WB |
| Immunogen | Purified tGFP protein expressed in E. coli. |
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR102D11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-Dendra2 Antibody, clone OTIR5C7
| Applications | WB |
Rabbit monoclonal anti-Dendra2 Antibody, clone OTIR5C7
| Applications | WB |
Rabbit monoclonal anti-His tag Antibody, clone OTIR5B12
| Applications | WB |
Rabbit monoclonal anti-His tag Antibody, clone OTIR5B12
| Applications | WB |
Rabbit Anti-Mouse IgG Secondary Antibody
| Applications | WB, IHC, IF/ICC, ELISA |
| Reactivities | Mouse IgG |
| Conjugation | Unconjugated |
| Immunogen | Mouse IgG, whole molecule |
Rabbit Polyclonal mKate Antibody
| Applications | WB |
| Immunogen | Purified mKate protein expressed in E. coli. |
Anti-DDK (FLAG) rabbit polyclonal antibody
| Applications | WB |
| Immunogen | Synthetic peptide (DYKDDDDK) conjugated to KLH |
Rabbit Polyclonal mGFP Antibody
| Applications | WB |
| Immunogen | mGFP |
Rabbit Polyclonal antibody to MX1 (myxovirus (influenza virus) resistance 1, interferon-inducible protein p78 (mouse))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 194 and 475 of MX1 (Uniprot ID#P20591) |
Anti-Dendra2 rabbit polyclonal antibody
| Applications | WB |
| Immunogen | Purified Dendra2 protein expressed in E. coli. |
LYVE1 rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, FC, IF, IHC, WB |
| Reactivities | Human |
| Immunogen | Highly pure recombinant Human soluble LYVE-1 produced in insect cells (Cat.-No DA3525). It consists of amino acid 24 (Ser) to 232 (Gly) and is fused to a C-terminal His-tag (6xHis). |
Anti-MYC tag rabbit polyclonal antibody
| Applications | WB |
| Immunogen | Synthetic peptide (EQKLISEEDL) conjugated to KLH |
Anti-His tag rabbit polyclonal antibody
| Applications | WB |
| Immunogen | Synthetic peptide (HHHHHH) conjugated to KLH |
Rabbit Polyclonal eGFP Antibody
| Applications | WB |
| Immunogen | Purified eGFP protein expressed in E. coli. |
GPR44 / CRTH2 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | GPR44 / CRTH2 antibody was raised against synthetic 33 amino acid peptide from N-terminal extracellular domain of human GPR44 / CRTH2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey (91%); Dog, Pig (88%); Rabbit (85%); Bovine (82%). |
Rabbit Polyclonal Anti-EGFLAM Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-EGFLAM antibody is: synthetic peptide directed towards the C-terminal region of Human EGFLAM. Synthetic peptide located within the following region: TTAKDGLLLWRGDSPMRPNSDFISLGLRDGALVFSYNLGSGVASIMVNGS |
USD 428.00
In Stock
Rabbit Monoclonal Anti-Human IgG4 Antibody, Clone RM120
| Applications | ELISA: 50ng/well - 200ng/well for Capture;, 0.05ug/mL - 0.2ug/mL for Detection;, , WB: 0.5 ug/mL - 2 ug/mL;, ICC: 1 ug/mL-10ug/mL;, IHC: 1 ug/mL-10ug/mL |
| Reactivities | Human IgG4 |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-HA tag Antibody, clone OTIR5B11
| Applications | WB |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-HA tag Antibody, clone OTIR7C9
| Applications | WB |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-S100P antibody for SISCAPA, clone OTIR1F12
| Applications | SISCAPA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-ASSY antibody for SISCAPA, clone OTIR3F5
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-SPTB1 antibody for SISCAPA, clone OTIR2D2
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Category
Antibody Hosts
- Rabbit
Availabilities
- In Stock
Filter by
Target Symbol
- EGFR (25)
- MAPT (19)
- AKT1 (18)
- JUN (15)
- EZR (14)
- TP53 (14)
- ATF2 (13)
- BRCA1 (13)
- CD44 (13)
- CHEK1 (13)
- NR3C1 (13)
- RELA (13)
- BRAF (12)
- EIF4EBP1 (12)
- IRS1 (12)
- ESR1 (11)
- FOXO1 (11)
- PDGFRB (11)
- PRKCD (11)
- CREB1 (10)
- FGFR1 (10)
- GRIN2B (10)
- IKBKG (10)
- MDM2 (10)
- MET (10)
- PAK1 (10)
- RPS6KB1 (10)
- SRC (10)
- BAD (9)
- MAP2K1 (9)
- MAP2K4 (9)
- MAPK14 (9)
- MTOR (9)
- NFKB1 (9)
- RAF1 (9)
- BRCA2 (8)
- CASP3 (8)
- CCNB1 (8)
- CDC25A (8)
- CHUK (8)
- CSF1R (8)
- ERBB2 (8)
- FN1 (8)
- GSK3A (8)
- IGF1R (8)
- JAK2 (8)
- NFKB2 (8)
- NOS3 (8)
- PPP1R1B (8)
- PRKCA (8)
- PTK2 (8)
- PTPN11 (8)
- PXN (8)
- RUNX1 (8)
- SNCA (8)
- SOX2 (8)
- STAT5A (8)
- YWHAZ (8)
- ABL1 (7)
- ATF4 (7)
- CASP7 (7)
- CASP9 (7)
- CDK2 (7)
- CFLAR (7)
- CTNNB1 (7)
- EPHA2 (7)
- GCG (7)
- HDAC2 (7)
- HSF1 (7)
- MAPK3 (7)
- NFKBIA (7)
- RPS6KA5 (7)
- SMAD1 (7)
- STAT1 (7)
- STAT3 (7)
- SYK (7)
- AFP (6)
- AGT (6)
- APP (6)
- BCL2 (6)
- BCL2L1 (6)
- CCNE1 (6)
- CD274 (6)
- CEBPA (6)
- DPYSL2 (6)
- ELK1 (6)
- ERBB3 (6)
- GAB2 (6)
- HDAC1 (6)
- HDAC4 (6)
- HSPD1 (6)
- IKBKB (6)
- JUND (6)
- MAPK8 (6)
- MUC1 (6)
- MYB (6)
- PAK2 (6)
- POMC (6)
- PRKD1 (6)
- RB1 (6)
Reactivities
- Human (8971)
- Mouse (6493)
- Rat (5013)
- Bovine (90)
- Monkey (77)
- Dog (51)
- Chicken (45)
- Pig (37)
- Xenopus (22)
- Gorilla (21)
- Chimpanzee (20)
- Rabbit (20)
- Rhesus Monkey (19)
- Zebrafish (16)
- Gibbon (15)
- Hamster (14)
- X. tropicalis (14)
- Horse (12)
- SARS-CoV-2 (11)
- Primate (9)
- Sheep (9)
- Cow (8)
- Bat (6)
- Guinea Pig (6)
- Orang-Utan (6)
- Porcine (5)
- Feline (4)
- Drosophila (3)
- Murine (2)
- N-term and C-term DDK (2)
- C. elegans (1)
- Drosophila melanogaster (1)
- Equine (1)
- Escherichia coli (1)
- Ferret (1)
- Fish (1)
- Fungus (1)
- Goat (1)
- Mink (1)
- Opossum (1)
- Pufferfish (1)
- Streptococcus Pyogenes (1)
Applications
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Families
- Druggable Genome (5810)
- Transmembrane (2343)
- Transcription Factors (1300)
- Protein Kinase (907)
- Secreted Protein (833)
- ES Cell Differentiation/IPS (623)
- Stem cell - Pluripotency (380)
- Protease (335)
- GPCR (287)
- Adult stem cells (135)
- Phosphatase (115)
- Embryonic stem cells (101)
- Cancer stem cells (96)
- Stem cell relevant signaling - JAK/STAT signaling pathway (94)
- Nuclear Hormone Receptor (76)
- Induced pluripotent stem cells (59)
- Ion Channels: Other (56)
- P450 (56)
- Stem cell relevant signaling - DSL/Notch pathway (52)
- Ion Channels: Potassium (43)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (35)
- Ion Channels: Glutamate Receptors (30)
- Ion Channels: Transient receptor potential (28)
- Stem cell relevant signaling - Wnt Signaling pathway (27)
- Ion Channels: Cys-loop Receptors (16)
- Ion Channels: Sodium (15)
- Ion Channels: Cyclic nucleotide gated (7)
- Ion Channels: Calcium (5)
- Ion Channels: ATP Receptors (1)
Pathways
- Pathways in cancer (870)
- MAPK signaling pathway (607)
- Metabolic pathways (605)
- Focal adhesion (489)
- Neurotrophin signaling pathway (400)
- Prostate cancer (383)
- Regulation of actin cytoskeleton (383)
- Chemokine signaling pathway (356)
- ErbB signaling pathway (350)
- Insulin signaling pathway (318)
- Chronic myeloid leukemia (316)
- Cytokine-cytokine receptor interaction (315)
- Colorectal cancer (300)
- Pancreatic cancer (294)
- T cell receptor signaling pathway (281)
- Cell cycle (277)
- Neuroactive ligand-receptor interaction (275)
- Apoptosis (257)
- Small cell lung cancer (254)
- Endocytosis (253)
- Glioma (252)
- Melanoma (252)
- Toll-like receptor signaling pathway (250)
- Acute myeloid leukemia (249)
- Alzheimer's disease (247)
- Wnt signaling pathway (243)
- Calcium signaling pathway (241)
- Leukocyte transendothelial migration (236)
- Jak-STAT signaling pathway (232)
- GnRH signaling pathway (231)
- Fc gamma R-mediated phagocytosis (228)
- B cell receptor signaling pathway (226)
- Progesterone-mediated oocyte maturation (222)
- Natural killer cell mediated cytotoxicity (214)
- Non-small cell lung cancer (214)
- Adipocytokine signaling pathway (208)
- Endometrial cancer (208)
- Axon guidance (207)
- Adherens junction (205)
- Epithelial cell signaling in Helicobacter pylori infection (201)
- VEGF signaling pathway (199)
- Huntington's disease (197)
- Oocyte meiosis (196)
- Renal cell carcinoma (196)
- Fc epsilon RI signaling pathway (194)
- Tight junction (182)
- p53 signaling pathway (181)
- Bladder cancer (177)
- Melanogenesis (177)
- Gap junction (166)
- Vascular smooth muscle contraction (165)
- Amyotrophic lateral sclerosis (ALS) (156)
- mTOR signaling pathway (153)
- Long-term potentiation (152)
- NOD-like receptor signaling pathway (148)
- RIG-I-like receptor signaling pathway (135)
- Ubiquitin mediated proteolysis (130)
- TGF-beta signaling pathway (127)
- Cell adhesion molecules (CAMs) (125)
- Olfactory transduction (122)
- Long-term depression (121)
- Pathogenic Escherichia coli infection (120)
- Parkinson's disease (119)
- Type II diabetes mellitus (118)
- Hematopoietic cell lineage (107)
- ECM-receptor interaction (96)
- Dilated cardiomyopathy (91)
- Hypertrophic cardiomyopathy (HCM) (89)
- Thyroid cancer (89)
- Cytosolic DNA-sensing pathway (87)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (83)
- Viral myocarditis (82)
- Basal cell carcinoma (80)
- Purine metabolism (77)
- Complement and coagulation cascades (76)
- PPAR signaling pathway (74)
- Systemic lupus erythematosus (72)
- Prion diseases (68)
- Glycolysis / Gluconeogenesis (67)
- Dorso-ventral axis formation (66)
- Phosphatidylinositol signaling system (66)
- Oxidative phosphorylation (62)
- Vibrio cholerae infection (59)
- Lysosome (55)
- Notch signaling pathway (55)
- Antigen processing and presentation (53)
- Hedgehog signaling pathway (52)
- Arginine and proline metabolism (51)
- ABC transporters (48)
- Drug metabolism - cytochrome P450 (48)
- Metabolism of xenobiotics by cytochrome P450 (48)
- Primary immunodeficiency (45)
- Cardiac muscle contraction (44)
- Glycerolipid metabolism (41)
- Ribosome (41)
- Spliceosome (40)
- Arachidonic acid metabolism (38)
- Pyrimidine metabolism (38)
- Homologous recombination (37)
- Pyruvate metabolism (37)
- Inositol phosphate metabolism (36)
- Nucleotide excision repair (35)
- Retinol metabolism (35)
- Type I diabetes mellitus (35)
- Tyrosine metabolism (35)
- Fructose and mannose metabolism (33)
- Tryptophan metabolism (33)
- Base excision repair (32)
- Taste transduction (32)
- Valine (32)
- Alanine (31)
- Fatty acid metabolism (31)
- aspartate and glutamate metabolism (31)
- DNA replication (30)
- leucine and isoleucine degradation (30)
- Butanoate metabolism (27)
- Renin-angiotensin system (27)
- Mismatch repair (26)
- Regulation of autophagy (26)
- SNARE interactions in vesicular transport (26)
- Starch and sucrose metabolism (25)
- Cysteine and methionine metabolism (24)
- Glutathione metabolism (24)
- Glycerophospholipid metabolism (24)
- Graft-versus-host disease (24)
- Histidine metabolism (24)
- Pentose phosphate pathway (24)
- Proteasome (24)
- Androgen and estrogen metabolism (23)
- Nitrogen metabolism (23)
- Citrate cycle (TCA cycle) (22)
- Lysine degradation (22)
- Autoimmune thyroid disease (21)
- Allograft rejection (20)
- Galactose metabolism (20)
- RNA degradation (20)
- Amino sugar and nucleotide sugar metabolism (19)
- Basal transcription factors (19)
- Drug metabolism - other enzymes (19)
- Maturity onset diabetes of the young (19)
- Biosynthesis of unsaturated fatty acids (18)
- Non-homologous end-joining (18)
- Propanoate metabolism (18)
- Linoleic acid metabolism (17)
- Primary bile acid biosynthesis (17)
- beta-Alanine metabolism (17)
- Ether lipid metabolism (15)
- Sphingolipid metabolism (15)
- Glycine (14)
- N-Glycan biosynthesis (14)
- Porphyrin and chlorophyll metabolism (14)
- serine and threonine metabolism (14)
- Asthma (13)
- C21-Steroid hormone metabolism (13)
- Limonene and pinene degradation (13)
- Phenylalanine metabolism (13)
- Ascorbate and aldarate metabolism (12)
- Folate biosynthesis (11)
- Nicotinate and nicotinamide metabolism (11)
- Riboflavin metabolism (11)
- Taurine and hypotaurine metabolism (11)
- Aminoacyl-tRNA biosynthesis (10)
- Pentose and glucuronate interconversions (10)
- Selenoamino acid metabolism (9)
- alpha-Linolenic acid metabolism (9)
- Terpenoid backbone biosynthesis (8)
- Glyoxylate and dicarboxylate metabolism (7)
- Other glycan degradation (7)
- Caffeine metabolism (6)
- Chondroitin sulfate biosynthesis (6)
- Fatty acid biosynthesis (6)
- Glycosaminoglycan degradation (6)
- RNA polymerase (6)
- Steroid biosynthesis (6)
- Heparan sulfate biosynthesis (5)
- One carbon pool by folate (5)
- Pantothenate and CoA biosynthesis (5)
- Circadian rhythm - mammal (4)
- Glycosphingolipid biosynthesis - ganglio series (4)
- Lysine biosynthesis (4)
- Phenylalanine (4)
- leucine and isoleucine biosynthesis (4)
- tyrosine and tryptophan biosynthesis (4)
- Cyanoamino acid metabolism (3)
- Fatty acid elongation in mitochondria (3)
- Glycosphingolipid biosynthesis - lacto and neolacto series (3)
- Keratan sulfate biosynthesis (3)
- Methane metabolism (3)
- Sulfur metabolism (3)
- Synthesis and degradation of ketone bodies (3)
- Vitamin B6 metabolism (3)
- D-Glutamine and D-glutamate metabolism (2)
- Glycosylphosphatidylinositol(GPI)-anchor biosynthesis (2)
- O-Glycan biosynthesis (2)
- Protein export (2)
- Thiamine metabolism (2)
- Ubiquinone and other terpenoid-quinone biosynthesis (2)
- Glycosphingolipid biosynthesis - globo series (1)
- O-Mannosyl glycan biosynthesis (1)