USD 428.00
In Stock
DDK Rabbit monoclonal antibody,clone OTIR5G2, recognizes both N-terminal and C-terminal DDK tags
Applications | ELISA, IP, WB |
Conjugation | Unconjugated |
USD 428.00
In Stock
DDK Rabbit monoclonal antibody,clone OTIR5G2, recognizes both N-terminal and C-terminal DDK tags
Applications | ELISA, IP, WB |
Conjugation | Unconjugated |
USD 180.00
In Stock
DDK Rabbit monoclonal antibody,clone OTIR5G2, recognizes both N-terminal and C-terminal DDK tags
Applications | ELISA, IP, WB |
Conjugation | Unconjugated |
Anti-6X His tag rabbit polyclonal antibody
Applications | ELISA, IP, WB |
Immunogen | Rabbit Polyclonal antibody to 6X His tag |
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR102D11
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR094F2
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal tdTomato Antibody
Applications | WB |
Immunogen | tdTomato |
Rabbit Polyclonal mCherry Antibody
Applications | WB |
Immunogen | mCherry |
Rabbit Polyclonal turboGFP Antibody
Applications | WB |
Immunogen | Purified tGFP protein expressed in E. coli. |
Rabbit polyclonal anti-ABCC3 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ABCC3. |
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5H8
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5H8
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E3
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E3
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E4
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E4
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR102D11
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit monoclonal anti-Dendra2 Antibody, clone OTIR5C7
Applications | WB |
Rabbit monoclonal anti-Dendra2 Antibody, clone OTIR5C7
Applications | WB |
Rabbit monoclonal anti-His tag Antibody, clone OTIR5B12
Applications | WB |
Rabbit monoclonal anti-His tag Antibody, clone OTIR5B12
Applications | WB |
Rabbit Anti-Mouse IgG Secondary Antibody
Applications | WB, IHC, IF/ICC, ELISA |
Reactivities | Mouse IgG |
Conjugation | Unconjugated |
Immunogen | Mouse IgG, whole molecule |
Rabbit Polyclonal mKate Antibody
Applications | WB |
Immunogen | Purified mKate protein expressed in E. coli. |
Anti-DDK (FLAG) rabbit polyclonal antibody
Applications | WB |
Immunogen | Synthetic peptide (DYKDDDDK) conjugated to KLH |
Rabbit Polyclonal mGFP Antibody
Applications | WB |
Immunogen | mGFP |
Rabbit Polyclonal Anti-GPA33 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GPA33 |
Rabbit polyclonal anti-ABCC2 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ABCC2. |
Rabbit Polyclonal antibody to MX1 (myxovirus (influenza virus) resistance 1, interferon-inducible protein p78 (mouse))
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 194 and 475 of MX1 (Uniprot ID#P20591) |
Biotinylated Anti-Human IL-21 Rabbit Polyclonal Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human IL-21 |
Anti-Dendra2 rabbit polyclonal antibody
Applications | WB |
Immunogen | Purified Dendra2 protein expressed in E. coli. |
LYVE1 rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, FC, IF, IHC, WB |
Reactivities | Human |
Immunogen | Highly pure recombinant Human soluble LYVE-1 produced in insect cells (Cat.-No DA3525). It consists of amino acid 24 (Ser) to 232 (Gly) and is fused to a C-terminal His-tag (6xHis). |
Anti-MYC tag rabbit polyclonal antibody
Applications | WB |
Immunogen | Synthetic peptide (EQKLISEEDL) conjugated to KLH |
Anti-His tag rabbit polyclonal antibody
Applications | WB |
Immunogen | Synthetic peptide (HHHHHH) conjugated to KLH |
Rabbit Polyclonal Anti-LILRB2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human LILRB2 |
Rabbit anti-BRCA1 polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from humanBRCA1 around the phosphorylation site of serine 1423 (H-G-SP-Q-P). |
Rabbit Polyclonal Anti-NGF Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human NGF |
TNF alpha (TNF) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to amino acids 141-190 of Human TNF-α. |
Rabbit Polyclonal eGFP Antibody
Applications | WB |
Immunogen | Purified eGFP protein expressed in E. coli. |
EPO (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 20-48 amino acids from the N-terminal region of Human Erythropoietin. |
GPR44 / CRTH2 Rabbit Polyclonal (N-Terminus) Antibody
Applications | IHC |
Reactivities | Gibbon, Gorilla, Human |
Conjugation | Unconjugated |
Immunogen | GPR44 / CRTH2 antibody was raised against synthetic 33 amino acid peptide from N-terminal extracellular domain of human GPR44 / CRTH2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey (91%); Dog, Pig (88%); Rabbit (85%); Bovine (82%). |
Rabbit Polyclonal Anti-EGFLAM Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-EGFLAM antibody is: synthetic peptide directed towards the C-terminal region of Human EGFLAM. Synthetic peptide located within the following region: TTAKDGLLLWRGDSPMRPNSDFISLGLRDGALVFSYNLGSGVASIMVNGS |
Rabbit Polyclonal RHBDD2 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | RHBDD2 antibody was raised against an 18 amino acid peptide from near the center of human RHBDD2. |
USD 428.00
In Stock
Rabbit monoclonal anti-WT1 Antibody, clone OTIR5F11
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit monoclonal anti-UCHL1 Antibody, clone OTIR2F11
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Monoclonal Anti-Human IgG4 Antibody, Clone RM120
Applications | ELISA: 50ng/well - 200ng/well for Capture;, 0.05ug/mL - 0.2ug/mL for Detection;, , WB: 0.5 ug/mL - 2 ug/mL;, ICC: 1 ug/mL-10ug/mL;, IHC: 1 ug/mL-10ug/mL |
Reactivities | Human IgG4 |
Conjugation | Unconjugated |
Rabbit monoclonal antibody against Dnmt1(clone EPR3521(2))
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit monoclonal anti-HA tag Antibody, clone OTIR5B11
Applications | WB |
Conjugation | Unconjugated |
Rabbit monoclonal anti-HA tag Antibody, clone OTIR7C9
Applications | WB |
Conjugation | Unconjugated |
Rabbit monoclonal anti-S100P antibody for SISCAPA, clone OTIR1F12
Applications | SISCAPA |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit monoclonal anti-ASSY antibody for SISCAPA, clone OTIR3F5
Applications | SISCAPA |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit monoclonal anti-SPTB1 antibody for SISCAPA, clone OTIR2D2
Applications | SISCAPA |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |