Germany
Japan
United Kingdom
China
Rabbit Polyclonal GluR2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human GluR2 |
Antibodies
View as table Download
Rabbit anti-CHRM5 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CHRM5 |
Rabbit Polyclonal Anti-GPCR5A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GPCR5A antibody: synthetic peptide directed towards the C terminal of human GPCR5A. Synthetic peptide located within the following region: SQEEITQGFEETGDTLYAPYSTHFQLQNQPPQKEFSIPRAHAWPSPYKDY |
Rabbit Polyclonal Anti-TSHR Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TSHR antibody: synthetic peptide directed towards the N terminal of human TSHR. Synthetic peptide located within the following region: CHQEEDFRVTCKDIQRIPSLPPSTQTLKLIETHLRTIPSHAFSNLPNISR |
Rabbit Polyclonal Anti-NTSR1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NTSR1 antibody: synthetic peptide directed towards the N terminal of human NTSR1. Synthetic peptide located within the following region: FGNASGNASERVLAAPSSELDVNTDIYSKVLVTAVYLALFVVGTVGNTVT |
Rabbit Polyclonal Anti-CXCR4 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CXCR4 Antibody: A synthesized peptide derived from human CXCR4 |
Rabbit Polyclonal Anti-CHRM1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CHRM1 |
ADRB3 Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | ADRB3 antibody was raised against synthetic 18 amino acid peptide from C-terminus of human ADRB3. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Monkey (94%). |
Rabbit anti-CHRM1 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CHRM1 |
Rabbit Polyclonal Anti-TSHR Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TSHR antibody: synthetic peptide directed towards the C terminal of human TSHR. Synthetic peptide located within the following region: KLDAVYLNKNKYLTVIDKDAFGGVYSGPSLLLPLGRKSLSFETQKAPRSS |
Rabbit Polyclonal Anti-SUCNR1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SUCNR1 Antibody: A synthesized peptide derived from human SUCNR1 |
Rabbit Polyclonal antibody to Histamine H2 Receptor (histamine receptor H2)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 45 of Histamine H2 Receptor (Uniprot ID#P25021) |
Rabbit Polyclonal antibody to alpha 1a Adrenergic Receptor (adrenergic, alpha-1A-, receptor)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide contain a sequence corresponding to a region within amino acids 206 and 260 of alpha 1a Adrenergic Receptor (Uniprot ID#P35348) |
Rabbit polyclonal IL-8R beta/CDw128 beta (Ser347) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IL-8R beta/CDw128 beta around the phosphorylation site of serine 347 (R-P-SP-F-V). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-CCKBR antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CCKBR. |
Rabbit polyclonal anti-HTR7 antibody
| Applications | IF |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human HTR7. |
Rabbit polyclonal anti-GPR126 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GPR126. |
USD 425.00
In Stock
CHRM3 / M3 Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human, Monkey, Orang-Utan |
| Conjugation | Unconjugated |
| Immunogen | CHRM3 / M3 antibody was raised against synthetic 19 amino acid peptide from C-terminus of human CHRM3 / M3. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey (100%); Chimpanzee, Mouse, Rat, Sheep, Hamster, Elephant, Dog, Bovine, Horse, Rabbit, Pig, Guinea pig (95%); Opossum, Turkey, Chicken, Lizard (89%). |
FPR2 / FPRL1 Rabbit Polyclonal (Extracellular Domain) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | FPR2 / FPRL1 antibody was raised against synthetic 20 amino acid peptide from 2nd extracellular domain of human FPR2 / FPRL1. Percent identity with other species by BLAST analysis: Human (100%); Chimpanzee, Gorilla, Monkey (95%); Orangutan (90%); Dog (85%). |
B1R / BDKRB1 Rabbit Polyclonal (Extracellular Domain) Antibody
| Applications | IHC |
| Reactivities | Human, Monkey, Gorilla |
| Conjugation | Unconjugated |
| Immunogen | B1R / BDKRB1 antibody was raised against synthetic 18 amino acid peptide from 2nd extracellular domain of human BDKRB1. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Gibbon (94%); Rat, Hamster (89%); Mouse, Rabbit, Horse (83%). |
Rabbit anti-PTH1R Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PTH1R |
P2RY6 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human P2RY6 |
Rabbit Polyclonal Anti-CCR2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CCR2 antibody: synthetic peptide directed towards the middle region of human CCR2. Synthetic peptide located within the following region: LIMVICYSGILKTLLRCRNEKKRHRAVRVIFTIMIVYFLFWTPYNIVILL |
Rabbit Polyclonal Anti-TSHR Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TSHR antibody: synthetic peptide directed towards the N terminal of human TSHR. Synthetic peptide located within the following region: ELIARNTWTLKKLPLSLSFLHLTRADLSYPSHCCAFKNQKKIRGILESLM |
Rabbit Polyclonal Anti-mGluR8 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-mGluR8 Antibody: A synthesized peptide derived from human mGluR8 |
Rabbit Polyclonal Anti-LGR5(GPR49) Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LGR5(GPR49) Antibody: Peptide sequence around aa.490~494(K-I-S-N-Q) derived from Human LGR5(GPR49). |
Active filters
Category
- Antibodies
Reactivities
- Human
Antibody Hosts
- Rabbit
Isotypes
- IgG
Clonalities
- Polyclonal
Conjugates
- Unconjugated
Families
- GPCR
Filter by
Target Symbol
- ADRA1B (9)
- GRM3 (9)
- ADRB2 (8)
- CCR5 (8)
- F2R (8)
- CXCR4 (7)
- HTR1A (7)
- HCRTR1 (6)
- HTR5A (6)
- PTGER3 (6)
- SSTR2 (6)
- TSHR (6)
- ADRA2A (5)
- ADRB3 (5)
- APLNR (5)
- CASR (5)
- CCR7 (5)
- CCR8 (5)
- CHRM1 (5)
- CX3CR1 (5)
- CXCR3 (5)
- FZD1 (5)
- FZD4 (5)
- GABBR1 (5)
- GPR4 (5)
- GRM2 (5)
- GRM7 (5)
- GRM8 (5)
- MAS1 (5)
- MC1R (5)
- NPY1R (5)
- P2RY2 (5)
- S1PR1 (5)
- S1PR3 (5)
- ADRA1A (4)
- AGTR2 (4)
- AVPR1B (4)
- BDKRB1 (4)
- CALCR (4)
- CALCRL (4)
- CCR3 (4)
- CNR2 (4)
- CXCR2 (4)
- CXCR6 (4)
- DRD1 (4)
- DRD5 (4)
- EDNRA (4)
- FSHR (4)
- FZD2 (4)
- FZD3 (4)
- FZD5 (4)
- FZD9 (4)
- GHRHR (4)
- GIPR (4)
- GPR15 (4)
- GPR161 (4)
- GPR27 (4)
- GPR68 (4)
- GPR75 (4)
- GPR78 (4)
- GRM1 (4)
- GRM4 (4)
- GRPR (4)
- HRH2 (4)
- HTR4 (4)
- LGR5 (4)
- LPAR3 (4)
- LPAR4 (4)
- MC4R (4)
- MC5R (4)
- MTNR1A (4)
- NTSR1 (4)
- OPN3 (4)
- OR13C5 (4)
- PTGDR2 (4)
- PTGER2 (4)
- QRFPR (4)
- RXFP3 (4)
- S1PR2 (4)
- SSTR1 (4)
- SSTR5 (4)
- ACKR1 (3)
- ACKR2 (3)
- ADGRE5 (3)
- ADORA1 (3)
- ADORA2A (3)
- ADORA3 (3)
- ADRA1D (3)
- ADRB1 (3)
- AGTR1 (3)
- AVPR2 (3)
- BDKRB2 (3)
- CCR1 (3)
- CCR4 (3)
- CCR6 (3)
- CHRM2 (3)
- CHRM5 (3)
- CMKLR1 (3)
- DRD4 (3)
- EDNRB (3)
Applications
Modifications
Pathways
- Neuroactive ligand-receptor interaction (482)
- Calcium signaling pathway (156)
- Chemokine signaling pathway (61)
- Cytokine-cytokine receptor interaction (61)
- Endocytosis (44)
- Melanogenesis (40)
- Vascular smooth muscle contraction (37)
- Basal cell carcinoma (32)
- Colorectal cancer (32)
- Pathways in cancer (32)
- Wnt signaling pathway (32)
- Regulation of actin cytoskeleton (27)
- Gap junction (23)
- Complement and coagulation cascades (17)
- Olfactory transduction (13)
- Renin-angiotensin system (12)
- Long-term depression (8)
- Axon guidance (7)
- Leukocyte transendothelial migration (7)
- Long-term potentiation (7)
- Autoimmune thyroid disease (6)
- Epithelial cell signaling in Helicobacter pylori infection (5)
- Taste transduction (4)
- Dilated cardiomyopathy (3)
- GnRH signaling pathway (3)
- Huntington's disease (3)
- Parkinson's disease (3)