Rabbit Polyclonal Anti-BDNF Antibody
| Applications | IHC, WB |
| Reactivities | Human, Macaque, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BDNF antibody: synthetic peptide directed towards the middle region of human BDNF. Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG |
Rabbit polyclonal anti-Wnt1 antibody
| Applications | WB |
| Reactivities | Bovine, Human, Macaque, Mouse, Opossum, Rat, Dog |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of human Wnt1 protein. |
Rabbit Polyclonal Anti-IFN-gamma Antibody
| Reactivities | Human, Rhesus Macaque |
| Conjugation | Unconjugated |
| Immunogen | For immunization recombinant human IFN-gamma (E.coli-derived) is used |
Rabbit Polyclonal Anti-IL-12p70 Antibody
| Reactivities | Human, Rhesus Macaque |
| Conjugation | Unconjugated |
| Immunogen | For immunization recombinant human IL-12p70 (CHO-derived) is used |
Rabbit Polyclonal Anti-IL-12p70 Antibody, Biotin conjugated
| Reactivities | Human, Rhesus Macaque |
| Conjugation | Unconjugated |
| Immunogen | For immunization recombinant human IL-12p70 (CHO-derived) is used |
Germany
Japan
United Kingdom
China
