Antibodies

Jump to Filters
View as table Download
Macrophage Scavenger Receptor I (MSR1) (300-400) Rabbit Polyclonal Antibody
RA25074-100

USD 360.00

2 Weeks

Macrophage Scavenger Receptor I (MSR1) (300-400) rabbit polyclonal antibody

Applications IF, IHC, WB
Reactivities Bovine, Canine, Human, Mouse, Primate, Rat
Conjugation Unconjugated
Semaphorin 3B (SEMA3B) (100-200) Rabbit Polyclonal Antibody
RA25088-50

USD 410.00

2 Weeks

Semaphorin 3B (SEMA3B) (100-200) rabbit polyclonal antibody

Applications IF, IHC, WB
Reactivities Bovine, Canine, Human, Mouse, Primate, Rat
Conjugation Unconjugated
Cripto1 (TDGF1) Rabbit Polyclonal Antibody
RA25091-100

USD 380.00

2 Weeks

Cripto1 (TDGF1) rabbit polyclonal antibody

Applications FC, IF, WB
Reactivities Bovine, Canine, Human, Mouse, Primate, Rat
Conjugation Unconjugated
Nucleobindin 2 (NUCB2) Rabbit Polyclonal Antibody
TA341643

USD 310.00

5 Days

Rabbit Polyclonal Anti-NUCB2 Antibody

Applications IHC, WB
Reactivities Canine, Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-NUCB2 antibody: synthetic peptide directed towards the middle region of human NUCB2. Synthetic peptide located within the following region: MMKEHERREYLKTLNEEKRKEEESKFEEMKKKHENHPKVNHPGSKDQLKE
Bmi1 (COMMD3-BMI1) (1-100) Rabbit Polyclonal Antibody
RA25083-100

USD 440.00

2 Weeks

Bmi1 (COMMD3-BMI1) (1-100) rabbit polyclonal antibody

Applications IF, WB
Reactivities Bovine, Canine, Chicken, Feline, Human, Mouse, Primate, Rabbit, Rat, Zebrafish
Conjugation Unconjugated
Angiopoietin 1 (ANGPT1) (C-term) Rabbit Polyclonal Antibody
RA26000-100

USD 460.00

2 Weeks

Angiopoietin 1 (ANGPT1) (C-term) rabbit polyclonal antibody

Applications IHC, WB
Reactivities Canine, Human, Rabbit, Rat
Conjugation Unconjugated
EDG8 (S1PR5) Rabbit Polyclonal Antibody
TA337040

USD 424.00

5 Days

Rabbit Polyclonal S1P5/EDG-8 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Canine, Primate
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to amino acids 15-55 of human Edg8 was used as the immunogen, GenBank no NP_110387.
CD137 (TNFRSF9) Rabbit Polyclonal Antibody
TA343047

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-TNFRSF9 Antibody

Applications WB
Reactivities Canine, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TNFRSF9 antibody: synthetic peptide directed towards the C terminal of human TNFRSF9. Synthetic peptide located within the following region: LTLRFSVVKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL
MTSS1 Rabbit Polyclonal Antibody
TA337043

USD 410.00

5 Days

Rabbit Polyclonal MTSS1 Antibody

Applications WB
Reactivities Canine, Chicken, Human, Mouse, Primate, Rat
Conjugation Unconjugated
Immunogen A portion of amino acid 150-200 of human MTSS1 protein was used as the immunogen.