Rabbit Polyclonal Anti-SDF 1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SDF 1 Antibody: A synthesized peptide derived from human SDF 1 |
Rabbit Polyclonal Anti-SDF 1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SDF 1 Antibody: A synthesized peptide derived from human SDF 1 |
Rabbit Polyclonal CXCL12 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | CXCL12 antibody was raised against a 16 amino acid peptide near the center of human CXCL12 |
Rabbit polyclonal anti-SDF-1beta antibody
Applications | WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | E. coli-expressed mouse SDF-1β |
Rabbit Polyclonal Anti-CXCL12 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CXCL12 antibody: synthetic peptide directed towards the middle region of human CXCL12. Synthetic peptide located within the following region: VKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM |
Anti-CXCL12 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 36-50 amino acids of human chemokine (C-X-C motif) ligand 12 |
Anti-CXCL12 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 36-50 amino acids of human chemokine (C-X-C motif) ligand 12 |