Antibodies

View as table Download

Rabbit anti-DCTN2 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human DCTN2

Rabbit Polyclonal Anti-DCTN2 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DCTN2 antibody: synthetic peptide directed towards the N terminal of human DCTN2. Synthetic peptide located within the following region: ADPKYADLPGIARNEPDVYETSDLPEDDQAEFDAFAQELEELTSTSVEHI

Rabbit Polyclonal Anti-p50 Dynamitin Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-p50 Dynamitin Antibody: A synthesized peptide derived from human p50 Dynamitin

Rabbit polyclonal p50 Dynamitin antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human p50 dynamitin.

Dynamitin (DCTN2) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide, corresponding to amino acids 340-390 of Human Dynactin 2.

Dynamitin (DCTN2) (Center) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 191-219 amino acids from the Central region of Human Dynactin subunit 2.

Rabbit Polyclonal Anti-DCTN2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human DCTN2