Rabbit Polyclonal Anti-CA1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CA1 antibody: synthetic peptide directed towards the N terminal of human CA1. Synthetic peptide located within the following region: ASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVS |
CA1 (Erythrocytes) rabbit polyclonal antibody, Azide Free
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Bovine |
| Immunogen | Carbonic Anhydrase isolated and purified from Bovine Erythrocytes. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
CA1 (Erythrocytes) rabbit polyclonal antibody, Biotin
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Bovine |
| Conjugation | Biotin |
| Immunogen | Carbonic Anhydrase isolated and purified from Bovine Erythrocytes. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
CA1 (Erythrocytes) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Bovine |
| Immunogen | Carbonic Anhydrase isolated and purified from Bovine Erythrocytes. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Carbonic Anhydrase I (CA1) (Erythrocytes) rabbit polyclonal antibody, Azide Free
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Human |
| Immunogen | Carbonic Anhydrase I isolated and purified from Human Erythrocytes. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Carbonic Anhydrase I (CA1) (Erythrocytes) rabbit polyclonal antibody, Biotin
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Carbonic Anhydrase I isolated and purified from Human Erythrocytes. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Carbonic Anhydrase I (CA1) (Erythrocytes) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Human |
| Immunogen | Carbonic Anhydrase I isolated and purified from Human Erythrocytes. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Rabbit anti-CA1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CA1 |
Anti-CA1 Rabbit Polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Anti-CA1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
USD 380.00
4 Weeks
Carbonic Anhydrase 1 Rabbit monoclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
