Rabbit Polyclonal Anti-FOXA1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FOXA1 antibody: synthetic peptide directed towards the N terminal of human FOXA1. Synthetic peptide located within the following region: MLGTVKMEGHETSDWNSYYADTQEAYSSVPVSNMNSGLGSMNSMNTYMTM |
Rabbit monoclonal antibody against FOXA1(clone EP4131)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
FOXA1 (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 270-299 amino acids from the Central region of Human FOXA1 / TCF3A |
Rabbit Polyclonal FOXA1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Rabbit polyclonal FOXA1 antibody was raised against a 17 amino acid peptide near the center of human FOXA1. |
Rabbit Polyclonal Anti-FOXA1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FOXA1 antibody: synthetic peptide directed towards the N terminal of human FOXA1. Synthetic peptide located within the following region: LGTVKMEGHETSDWNSYYADTQEAYSSVPVSNMNSGLGSMNSMNTYMTMN |
Rabbit anti FOXA-1 Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-FOXA1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human FOXA1 |
FOXA1 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 263-472 of human FOXA1 (NP_004487.2). |
| Modifications | Unmodified |
FOXA1 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human FOXA1 |
FOXA Rabbit polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human FOXA1 around the non-acetylation site of Lys265. AA range:231-280 |
Germany
Japan
United Kingdom
China
