Antibodies

Jump to Filters
View as table Download
Cytokeratin 19 (KRT19) Rabbit Polyclonal Antibody
TA313117

USD 345.00

4 Weeks

Rabbit polyclonal Keratin 19 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Keratin 19.
Cytokeratin 19 (KRT19) Rabbit Polyclonal Antibody
TA346188

USD 475.00

5 Days

Rabbit Polyclonal Anti-KRT19 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-KRT19 antibody is: synthetic peptide directed towards the middle region of Human KRT19. Synthetic peptide located within the following region: DMRSQYEVMAEQNRKDAEAWFTSRTEELNREVAGHTEQLQMSRSEVTDLR
Cytokeratin 19 (KRT19) Rabbit Polyclonal Antibody
TA347413

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-Keratin 19 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Keratin 19 Antibody: A synthesized peptide derived from human Keratin 19
Cytokeratin 19 (KRT19) Rabbit Polyclonal Antibody
AP31607PU-N

USD 440.00

2 Weeks

Cytokeratin 19 (KRT19) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide
Cytokeratin 19 (KRT19) Rabbit Polyclonal Antibody
TA336489

USD 424.00

5 Days

Rabbit Polyclonal Cytokeratin 19 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide derived from the C-terminal region of human Cytokeratin 19 (between residues 350-400) [UniProt P08727]
Cytokeratin 19 (KRT19) Rabbit Polyclonal Antibody
TA336845

USD 424.00

5 Days

Rabbit Polyclonal Cytokeratin 19 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide made to an N-terminal portion of the human Cytokeratin 19 protein (between residues 1-50) [UniProt P08727]
Cytokeratin 19 (KRT19) Rabbit Polyclonal Antibody
TA354724

USD 355.00

5 Days

Rabbit anti Cytokeratin-19 (CK-19) Polyclonal Antibody

Applications IHC, WB
Reactivities Bovine, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the N-terminus of human Cytokeratin protein.