Cytokeratin 19 (KRT19) Rabbit Polyclonal Antibody

CAT#: TA346188

Rabbit Polyclonal Anti-KRT19 Antibody


USD 475.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
Recombinant protein of human keratin 19 (KRT19)
    • 20 ug

USD 823.00


Transient overexpression lysate of keratin 19 (KRT19)
    • 100 ug

USD 396.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Other products for "KRT19"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-KRT19 antibody is: synthetic peptide directed towards the middle region of Human KRT19. Synthetic peptide located within the following region: DMRSQYEVMAEQNRKDAEAWFTSRTEELNREVAGHTEQLQMSRSEVTDLR
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 44 kDa
Gene Name keratin 19
Background KRT19 involved in the organization of myofibers. Together with KRT8, KRT19 helps to link the contractile apparatus to dystrophin at the costameres of striated muscle.
Synonyms CK19; K1CS; K19
Note Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Pig: 93%; Rat: 93%; Mouse: 92%; Bovine: 86%; Guinea pig: 85%; Goat: 77%; Sheep: 77%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.