Rabbit Polyclonal Anti-Nr5a1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Nr5a1 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Nr5a1. Synthetic peptide located within the following region: VADQMTLLQNCWSELLVLDHIYRQVQYGKEDSILLVTGQEVELSTVAVQA |
Rabbit Polyclonal anti-NR5A1 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR5A1 antibody: synthetic peptide directed towards the middle region of human NR5A1. Synthetic peptide located within the following region: AVPGAHGPLAGYLYPAFPGRAIKSEYPEPYASPPQPGLPYGYPEPFSGGP |
Rabbit Polyclonal Anti-NR5A1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR5A1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: QLHALQLDRQEFVCLKFLILFSLDVKFLNNHSLVKDAQEKANAALLDYTL |
Rabbit Polyclonal Anti-NR5A1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR5A1 antibody: synthetic peptide directed towards the middle region of human NR5A1. Synthetic peptide located within the following region: PGAHGPLAGYLYPAFPGRAIKSEYPEPYASPPQPGLPYGYPEPFSGGPNV |
Rabbit Polyclonal Anti-NR5A1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR5A1 antibody: synthetic peptide directed towards the middle region of human NR5A1. Synthetic peptide located within the following region: SLHGPEPKGLAAGPPAGPLGDFGAPALPMAVPGAHGPLAGYLYPAFPGRA |
Rabbit Polyclonal Anti-NR5A1 Antibody (Ligand-binding Domain)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | NR5A1 / SF1 antibody was raised against synthetic 16 amino acid peptide from ligand-binding domain of human NR5A1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Mouse, Rat, Hamster, Elephant, Dog, Horse, Pig (94%); Monkey, Sheep, Panda, Bovine, Rabbit (88%); Opossum, Platypus (81%). |
Rabbit Polyclonal Anti-NR5A1 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | NR5A1 / SF1 antibody was raised against synthetic 17 amino acid peptide from internal region of human NR5A1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Bat (100%); Elephant, Panda, Dog, Bovine, Rabbit, Horse, Pig (94%); Mouse, Rat, Hamster (88%); Turkey, Chicken, Platypus, Xenopus (82%). |
NR5A1 Antibody - middlel region
| Applications | WB |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse NR5A1 |
Steroidogenic factor-1 (SF-1/NR5A1) Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human Steroidogenic factor-1 (SF-1/Steroidogenic factor-1 (SF-1/NR5A1)) (NP_004950.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
