Rabbit Polyclonal Anti-MKNK1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MKNK1 Antibody: A synthesized peptide derived from human MKNK1 |
Rabbit Polyclonal Anti-MKNK1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MKNK1 Antibody: A synthesized peptide derived from human MKNK1 |
Rabbit polyclonal Mnk1 (Ab-385) antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Mnk1 around the phosphorylation site of threonine 385 (L-P-TP-P-Q). |
Rabbit polyclonal anti-MKNK1 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MKNK1. |
Rabbit polyclonal MNK1 (Thr255) antibody(Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human MNK1 around the phosphorylation site of threonine 255 (L-T-TP-P-C). |
Modifications | Phospho-specific |
Rabbit polyclonal anti-MNK1 antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human MNK1. |
Rabbit Polyclonal Anti-MKNK1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MKNK1 antibody: synthetic peptide directed towards the C terminal of human MKNK1. Synthetic peptide located within the following region: HEENELAEEPEALADGLCSMKLSPPCKSRLARRRALAQAGRGEDRSPPTA |
Rabbit Polyclonal Anti-MKNK1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MKNK1 antibody: synthetic peptide directed towards the N terminal of human MKNK1. Synthetic peptide located within the following region: CQGNKNILELIEFFEDDTRFYLVFEKLQGGSILAHIQKQKHFNEREASRV |