Calca rabbit polyclonal antibody
Applications | IF, IHC |
Reactivities | Human, Mammalian, Mouse, Porcine, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic rat alpha-CGRP coupled to bovine thyroglobulin (BTg) with glutaraldehyde. |
Calca rabbit polyclonal antibody
Applications | IF, IHC |
Reactivities | Human, Mammalian, Mouse, Porcine, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic rat alpha-CGRP coupled to bovine thyroglobulin (BTg) with glutaraldehyde. |
Rabbit polyclonal anti-TUBB(beta Tubulin) antibody, Loading control
Applications | WB |
Reactivities | Human, Mouse, Chicken, Xenopus, Porcine, Zebrafish, Hamster, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to the N-terminal region of human beta tubulin (within residues 1-100). Swiss-Prot P07437. |
Rabbit Polyclonal Antibody against ATG5
Applications | IHC, WB |
Reactivities | Human, Mouse, Porcine, Primate, Xenopus, Zebrafish, Cow, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an N-terminal region (within residues 1-50) of the human ATG5 protein. [Swiss-Prot# Q9H1Y0] |
Rabbit Polyclonal Antibody against SAT1
Applications | WB |
Reactivities | Human, Mouse, Porcine, Xenopus, Hamster, Cow, Rat, Chicken |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to a C-terminal region within residues 100-171 of the human protein. [Swiss-Prot# P21673] |
Rabbit Polyclonal Ki-67/MKI67 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Porcine |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal region of human Ki67 (within residues 1550-1700) [Swiss-Prot# P46013] |
Rabbit Polyclonal Antibody against UCHL1 (PGP9.5) - Neuronal Marker - Neuronal Marker
Applications | IHC, WB |
Reactivities | Human, Mouse, Monkey, Rat, Porcine, Horse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to a C-terminal portion of the human UCHL1 protein (between residues 200-223). [UniProt# P09936] |
Rabbit Polyclonal Antibody against PTGDS
Applications | WB |
Reactivities | Human, Primate, Mouse, Rat, Bovine, Porcine, Feline, Equine, Dog |
Conjugation | Unconjugated |
Immunogen | The epitope recognized by this antibody maps to region within residue 1-50 of human PTGDS. [Swiss-Prot# P41222] |
Rabbit Polyclonal Antibody against ADFP
Applications | IHC, WB |
Reactivities | Bovine, Human, Monkey, Mouse, Porcine |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal portion of the human protein, within residues 150-250. [Swiss-Prot# Q99541] |
Rabbit Polyclonal Antibody against VPS34
Applications | WB |
Reactivities | Human, Rat, Mouse, Porcine |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide made to an internal portion of the human protein (within residues 700-850). [Swiss-Prot# Q8NEB9] |
Rabbit Polyclonal Antibody against VEGFA
Applications | WB |
Reactivities | Human, Mouse, Dog, Horse, Cow, Rat, Chicken, Guinea Pig |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal region of the human VEGFA protein sequence (between residues 150-250). [Swiss-Prot# P15692] |
Rabbit Polyclonal Antibody against LOX
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Porcine, Cow |
Conjugation | Unconjugated |
Immunogen | A cocktail of two synthetic peptides; one made to a region of the human LOX protein within residues 300-400 and one within residues 200-300 |
Rabbit polyclonal anti human / porcine / rat C-Type Natriuretic Peptide (CNP) (32-53)
Applications | ELISA |
Reactivities | Human, Porcine, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide H-Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu- Asp-Arg-Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys-OH (disulfide bond) coupled to carrier protein. |
Rabbit Polyclonal TLR5 Antibody
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat, Porcine |
Conjugation | Unconjugated |
Immunogen | This antibody was developed against KLH-conjugated synthetic peptide corresponding to a portion of human TLR5 found between amino acids 300-350. It will cross-react with mouse and rat TLR5. |
Rabbit Polyclonal Antibody against TIP47
Applications | WB |
Reactivities | Human, Primate, Porcine |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to a region within the C-terminus (within residues 350-435) of the human TIP47 protein. [Swiss-Prot# O60664] |
Rabbit anti-ACAT2 polyclonal antibody
Applications | WB |
Reactivities | Human, Murine, Rat, Porcine, Ovine |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide derived from Human ACAT 2 |
BMP4 (20-34) rabbit polyclonal antibody
Applications | IHC |
Reactivities | Bovine, Chicken, Frog, Human, Mouse, Porcine, Rat, Zebrafish |
Conjugation | Unconjugated |
Rabbit anti-ACAT1 polyclonal antibody
Applications | WB |
Reactivities | Human, Porcine, Rat, Murine |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide derived from Human ACAT1. |
Rabbit Polyclonal Anti-FLI1 Antibody
Applications | WB |
Reactivities | Human, Porcine |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FLI1 antibody: synthetic peptide directed towards the N terminal of human FLI1. Synthetic peptide located within the following region: MDGTIKEALSVVSDDQSLFDSAYGAAAHLPKADMTASGSPDYGQPHKINP |
Rabbit Polyclonal Gastrokine 1 Antibody
Applications | WB |
Reactivities | Human, Equine, Porcine, Primate |
Conjugation | Unconjugated |
Immunogen | The portions of amino acids range between 100-150 of human GKN1 was used as the immunogen. |
Atrial Natriuretic Factor (1-28) (hu, bo, po); purified rabbit IgG
Applications | ELISA |
Reactivities | Human, Bovine, Porcine |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide H-Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met- Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr-OH (Disulfide bond) coupled to carrier protein. |