Antibodies

View as table Download

Rabbit Polyclonal Anti-TIM3 Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen TIM3 antibody was raised against a peptide corresponding to 16 amino acids near the amino terminus of human TIM3. The immunogen is located within amino acids 60 - 110 of TIM3.

HAVCR2 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human HAVCR2

Rabbit anti-HAVCR2 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human HAVCR2

Rabbit polyclonal anti-Tim-3 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide surrounding amino acid residue 285 of human Tim-3

Rabbit Polyclonal TIM-3 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen A portion of amino acids 100-200 of mouse TIM-3 protein were used as the immunogen.

Rabbit Polyclonal Anti-HAVCR2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HAVCR2 antibody: synthetic peptide directed towards the N terminal of human HAVCR2. Synthetic peptide located within the following region: MFSHLPFDCVLLLLLLLLTRSSEVEYRAEVGQNAYLPCFYTPAAPGNLVP

HAVCR2 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human HAVCR2

TIM-3/HAVCR2 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TIM-3/HAVCR2 (NP_116171.3).
Modifications Unmodified

TIM-3/HAVCR2 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 22-202 of human TIM-3/HAVCR2 (NP_116171.3).
Modifications Unmodified

TIM-3/HAVCR2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 22-202 of human TIM-3/HAVCR2 (NP_116171.3).

HAVCR2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of Mouse HAVCR2.
Modifications Unmodified