MORF4L1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human MORF4L1 |
MORF4L1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human MORF4L1 |
MORF4L1 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human MORF4L1 |
Rabbit Polyclonal Anti-MORF4L1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MORF4L1 Antibody: A synthesized peptide derived from human MORF4L1 |
Rabbit Polyclonal Anti-MORF4L1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MORF4L1 antibody: synthetic peptide directed towards the middle region of human MORF4L1. Synthetic peptide located within the following region: YAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILADHPDAPMSQ |
Rabbit Polyclonal anti-MORF4L1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-MORF4L1 antibody is: synthetic peptide directed towards the C-terminal region of Human MORF4L1. Synthetic peptide located within the following region: FNVMLGTQLLYKFERPQYAEILADHPDAPMSQVYGAPHLLRLFVRIGAML |
Rabbit Polyclonal Anti-MORF4L1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MORF4L1 antibody: synthetic peptide directed towards the N terminal of human MORF4L1. Synthetic peptide located within the following region: KDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTNLQKQRELQKANQEQYA |
Rabbit Polyclonal Anti-Morf4l1 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Morf4l1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: PEELKPWLVDDWDLITRQKQLFYLPAKKNVDSILEDYANYKKSRGNTDNK |
Rabbit Polyclonal Anti-MORF4L1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human MORF4L1 |
Morf4l1 Antibody - middle region
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
MORF4L1 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human MORF4L1 |
MORF4L1 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human MORF4L1 (NP_006782.1). |
Modifications | Unmodified |