Antibodies

View as table Download

MORF4L1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human MORF4L1

MORF4L1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human MORF4L1

Rabbit Polyclonal Anti-MORF4L1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-MORF4L1 Antibody: A synthesized peptide derived from human MORF4L1

Rabbit Polyclonal Anti-MORF4L1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MORF4L1 antibody: synthetic peptide directed towards the middle region of human MORF4L1. Synthetic peptide located within the following region: YAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILADHPDAPMSQ

Rabbit Polyclonal anti-MORF4L1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-MORF4L1 antibody is: synthetic peptide directed towards the C-terminal region of Human MORF4L1. Synthetic peptide located within the following region: FNVMLGTQLLYKFERPQYAEILADHPDAPMSQVYGAPHLLRLFVRIGAML

Rabbit Polyclonal Anti-MORF4L1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MORF4L1 antibody: synthetic peptide directed towards the N terminal of human MORF4L1. Synthetic peptide located within the following region: KDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTNLQKQRELQKANQEQYA

Rabbit Polyclonal Anti-Morf4l1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Morf4l1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: PEELKPWLVDDWDLITRQKQLFYLPAKKNVDSILEDYANYKKSRGNTDNK

Rabbit Polyclonal Anti-MORF4L1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human MORF4L1

Morf4l1 Antibody - middle region

Applications WB
Reactivities Mouse
Conjugation Unconjugated

MORF4L1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human MORF4L1

MORF4L1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human MORF4L1 (NP_006782.1).
Modifications Unmodified