Germany
Japan
United Kingdom
China
Rabbit Polyclonal Anti-SDF 1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SDF 1 Antibody: A synthesized peptide derived from human SDF 1 |
Antibodies
View as table Download
Rabbit polyclonal anti-SDF-1beta antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | E. coli-expressed mouse SDF-1β |
Anti-Human SDF-1a Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Human SDF-1α (CXCL12) |
Rabbit Polyclonal Anti-CXCL12 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CXCL12 antibody: synthetic peptide directed towards the middle region of human CXCL12. Synthetic peptide located within the following region: VKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM |
Anti-CXCL12 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 36-50 amino acids of human chemokine (C-X-C motif) ligand 12 |
Active filters
Target Symbol
- CXCL12
Antibody Hosts
- Rabbit
Conjugates
- Unconjugated
Families
- Druggable Genome
Pathways
- Leukocyte transendothelial migration