Rabbit Polyclonal SIRP alpha Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | SIRP alpha antibody was raised against a peptide corresponding to amino acids near the carboxy terminus of human SIRP alpha 1? The sequences of the immunogenic peptide differ from those of mouse, rat and bovine by one amino acid. |
Rabbit Polyclonal Anti-SHPS1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SHPS1 Antibody: A synthesized peptide derived from human SHPS1 |
Rabbit Polyclonal Anti-SIRPA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SIRPA antibody: synthetic peptide directed towards the C terminal of human SIRPA. Synthetic peptide located within the following region: QTSPQPASEDTLTYADLDMVHLNRTPKQPAPKPEPSFSEYASVQVPRK |
Germany
Japan
United Kingdom
China
