Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit anti-CNP Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CNP |
Rabbit Polyclonal Anti-CNPase Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CNPase Antibody: Peptide sequence around aa.80~84 (M-V-S-A-D |
rabbit Anti-CNP (2,3-cyclic nucleotide-3-phosphodiesterase) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rabbit, Rat, Sheep |
| Conjugation | Unconjugated |
| Immunogen | Endogenous rabbit 2,3 cyclic nucleotide-3-phospho-diesterase |
Rabbit Polyclonal Anti-CNP Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CNP antibody: synthetic peptide directed towards the middle region of human CNP. Synthetic peptide located within the following region: LYSLGNGRWMLTLAKNMEVRAIFTGYYGKGKPVPTQGSRKGGALQSCTII |
Rabbit Polyclonal Anti-CNP Antibody
| Applications | IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CNP antibody: synthetic peptide directed towards the N terminal of human CNP. Synthetic peptide located within the following region: YKITPGARGAFSEEYKRLDEDLAAYCRRRDIRILVLDDTNHERERLEQLF |
Active filters
Target Symbol
- CNP
Antibody Hosts
- Rabbit
Isotypes
- IgG
Conjugates
- Unconjugated