CNPase (CNP) Rabbit Polyclonal Antibody

CAT#: TA334679

Rabbit Polyclonal Anti-CNP Antibody

Product Images

WB Suggested Anti-CNP Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500 Positive Control: Fetal Muscle

• 

  Host: Rabbit; Target Name: CNP; Sample Tissue: Human Fetal Heart; Antibody Dilution: 1.0 ug/ml

• 

  Brain, cortex

• 

  human optic nerve and spinal cord

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CNP antibody: synthetic peptide directed towards the middle region of human CNP. Synthetic peptide located within the following region: LYSLGNGRWMLTLAKNMEVRAIFTGYYGKGKPVPTQGSRKGGALQSCTII
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 47 kDa
• Gene Name: 2',3'-cyclic nucleotide 3' phosphodiesterase
• Database Link:
  NP_149124
  Entrez Gene 1267 Human
  UniProt ID P09543
• Background: CNP belongs to the cyclic nucleotide phosphodiesterase family. It interacts with tubulin and promotes microtubule assembly for process outgrowth in oligodendrocytes. reduced CNP expression in the schizophrenic brain is relevant to disease etiology and therefore provide support for the general hypothesis that altered oligodendrocyte function is an etiological factor in schizophrenia.
• Synonyms: CNP1
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Horse: 93%; Rabbit: 93%; Rat: 86%; Mouse: 86%; Pig: 79%