Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal ABCA1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Hamster |
| Conjugation | Unconjugated |
| Immunogen | Partial peptide sequence (peptide used resides somewhere between a.a 1100-1300) of the human ABCA1 gene. Actual immunogen sequence is proprietary information. |
ABCA1 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ABCA1 |
TA373063 is a possible alternative to TA322600.
Rabbit anti-ABCA1 polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide derived from Human ABCA1. |
Anti-ABCA1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around aa.2253~2257(D-E-K-V-K) derived from Human ABCA1. |
Rabbit Polyclonal Anti-Abca1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Abca1 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: NRRAFGDKQSCLHPFTEDDAVDPNDSDIDPESRETDLLSGMDGKGSYQLK |
ABCA1 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1870-2120 of human ABCA1 (NP_005493.2). |
| Modifications | Unmodified |
ABCA1 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1870-2120 of human ABCA1 (NP_005493.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- ABCA1
Antibody Hosts
- Rabbit
Conjugates
- Unconjugated