Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal GPVI Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | GPVI antibody was raised against a 18 amino acid synthetic peptide near the center of the human GPVI. The immunogen is located within amino acids 130 - 180 of GPVI. |
Rabbit Polyclonal Anti-GP6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GP6 antibody: synthetic peptide directed towards the middle region of human GP6. Synthetic peptide located within the following region: PPSPVAEFSEATAELTVSFTNEVFTTETSRSITASPKESDSPAGPARQYY |
GP6 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human GP6 |
GP6 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human GP6 (NP_057447.4). |
| Modifications | Unmodified |
Active filters
Target Symbol
- GP6
Antibody Hosts
- Rabbit
Conjugates
- Unconjugated