Antibodies

View as table Download

Rabbit Monoclonal Antibody against MUC1 (Clone EP1024Y)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit polyclonal CD227/MUC1 (Tyr1229) antibody(Phospho-specific)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human CD227/MUC1 around the phosphorylation site of tyrosine 1229 (S-P-YP-E-K)
Modifications Phospho-specific

Rabbit Polyclonal MUC-1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Porcine
Conjugation Unconjugated
Immunogen Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal region between aa 1200-1250 of human MUC1 (NP_001037855). Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL.

Rabbit Polyclonal Anti-Phospho-CD227/MUC1(Tyr1229) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-Phospho-CD227/MUC1(Tyr1229) Antibody: A synthesized peptide derived from human CD227/MUC1 around the phosphorylation site of Tyrosine 1229
Modifications Phospho-specific

Rabbit polyclonal CD227/MUC1 antibody

Applications IF, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human CD227/MUC1.

Rabbit polyclonal anti-PGRMC2 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human PGRMC2.

Rabbit Polyclonal MUC1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen MUC1 antibody was raised against a 17 amino acid peptide near the carboxy terminus of human MUC1. The immunogen is located within the last 50 amino acids of MUC1 .

Rabbit Polyclonal Anti-MUC1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human MUC1

Rabbit Polyclonal Anti-MUC1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human MUC1

Rabbit Polyclonal Anti-MUC1(NT) Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human MUC1(NT)

Rabbit Polyclonal Anti-MUC1(CT) Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human MUC1(CT)

MUC1 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human MUC1

MUC1 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1182-1255aa of human MUC1 (NP_002708.1).
Modifications Unmodified

Recombinant Anti-MUC1 (Clone SM3)

Applications ELISA, FC, IHC
Reactivities Human
Conjugation Unconjugated
Modifications This chimeric rabbit antibody was made using the variable domain sequences of the original murine IgG1 format, for improved compatibility with existing reagents, assays and techniques.

Recombinant Anti-MUC1 (Clone Mc5)

Applications ELISA, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated
Modifications This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG2 format, for improved compatibility with existing reagents, assays and techniques.

Recombinant Anti-MUC1 (Clone HMFG2)

Applications ELISA, IHC
Reactivities Human
Conjugation Unconjugated
Modifications This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques.

Recombinant Anti-MUC1 (Clone HMFG1 (1.10.F3))

Applications ELISA, IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated
Modifications This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques.

Recombinant Anti-MUC1 (Clone PAM4)

Applications ELISA, FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Modifications This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques.