Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit anti-HDAC8 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human HDAC8 |
Rabbit Polyclonal HDAC8 (Ser39) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human HDAC8 around the phosphorylation site of Serine 39 |
| Modifications | Phospho-specific |
Rabbit Polyclonal HDAC8 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human HDAC8 |
Rabbit Polyclonal Anti-HDAC8 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HDAC8 antibody: synthetic peptide directed towards the C terminal of human HDAC8. Synthetic peptide located within the following region: TGVILGKTLSSEIPDHEFFTAYGPDYVLEITPSCRPDRNEPHRIQQILNY |
Rabbit anti-HDAC8 (Phospho-Ser39) polyclonal antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanHDAC8 around the phosphorylation site of serine 39 (R-A-SP-M-V). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-HDAC8 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 10 of mouse HDAC-8 |
Rabbit polyclonal anti-HDAC8 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E. coli-expressed recombinant human HDAC8 |
Rabbit Polyclonal Anti-HDAC8 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HDAC8 antibody: synthetic peptide directed towards the N terminal of human HDAC8. Synthetic peptide located within the following region: MEEPEEPADSGQSLVPVYIYSPEYVSMCDSLAKIPKRASMVHSLIEAYAL |
Active filters
Target Symbol
- HDAC8
Antibody Hosts
- Rabbit
Families
- Druggable Genome