ENaC Gamma Rabbit Polyclonal (C-Terminus) Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | SCNN1G / ENaC Gamma antibody was raised against synthetic peptide from human SCNN1G. |
ENaC Gamma Rabbit Polyclonal (C-Terminus) Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | SCNN1G / ENaC Gamma antibody was raised against synthetic peptide from human SCNN1G. |
Rabbit polyclonal SCNN1A Antibody (Center)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This SCNN1A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 365-391 amino acids from the Central region of human SCNN1A. |
Rabbit polyclonal antibody to SCNN1A (sodium channel, nonvoltage-gated 1 alpha)
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 182 and 459 of SCNN1A (Uniprot ID#P37088) |
ACCN1 (ASIC2) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 127~156 amino acids from the Center region of human ACCN1 |
Rabbit Polyclonal Anti-ACCN1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ACCN1 antibody: synthetic peptide directed towards the middle region of human ACCN1. Synthetic peptide located within the following region: LLDLLGKEEDEGSHDENVSTCDTMPNHSETISHTVNVPLQTTLGTLEEIA |
Anti-SCNN1B Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 260-514 amino acids of human sodium channel, non-voltage-gated 1, beta subunit |
Rabbit polyclonal Anti-ASIC2a
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | Peptide DLKESPSEGSLQPSSIQC, corresponding to amino acid residues 2-18 of human ASIC2a. Intracellular, N-terminus. |
Rabbit Polyclonal Anti-SCNN1B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SCNN1B antibody: synthetic peptide directed towards the C terminal of human SCNN1B. Synthetic peptide located within the following region: QPDTAPRSPNTGPYPSEQALPIPGTPPPNYDSLRLQPLDVIESDSEGDAI |
Rabbit Polyclonal Anti-ACCN1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ACCN1 antibody: synthetic peptide directed towards the C terminal of human ACCN1. Synthetic peptide located within the following region: GDIGGQMGLFIGASILTILELFDYIYELIKEKLLDLLGKEEDEGSHDENV |
Rabbit Polyclonal Anti-SCNN1A Antibody
Applications | IHC |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SCNN1A |
Rabbit Polyclonal anti-SCNN1A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human SCNN1A |
Rabbit Polyclonal anti-SCNN1A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human SCNN1A |
Special Offer: Get this product for $99/€99. Use code: "Truesample".