Antibodies

View as table Download

Rabbit anti-NR5A2 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human NR5A2

Rabbit Monoclonal antibody against NR5A2

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-HNF4A Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 241-254 amino acids of human hepatocyte nuclear factor 4, alpha

Rabbit polyclonal HNF4A Antibody (Center)

Applications FC, IF, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen This HNF4A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 281-312 amino acids from the Central region of human HNF4A.

Rabbit Polyclonal Anti-HNF4alpha /gamma Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-HNF4alpha /gamma Antibody: A synthesized peptide derived from human HNF4alpha /gamma

Rabbit Polyclonal HNF4 alpha (Ser313) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human HNF4 alpha around the phosphorylation site of Serine 313
Modifications Phospho-specific

Rabbit Polyclonal HNF4 alpha Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human HNF4 alpha

Rabbit Polyclonal Anti-HNF4A Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-HNF4A antibody is: synthetic peptide directed towards the N-terminal region of Human HNF4A. Synthetic peptide located within the following region: MRLSKTLVDMDMADYSAALDPAYTTLEFENVQVLTMGNDTSPSEGTNLNA

Phospho-HNF4A-S304 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding S304 of human HNF4A
Modifications Phospho-specific

Rabbit Polyclonal Anti-HNF4A Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-HNF4A antibody: synthetic peptide directed towards the middle region of human HNF4A. Synthetic peptide located within the following region: LPFQELQIDDNEYAYLKAIIFFDPDAKGLSDPGKIKRLRSQVQVSLEDYI