Germany
Japan
United Kingdom
China
Antibodies
View as table Download
NFE2L2 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human NFE2L2 |
Rabbit Polyclonal Nrf2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Nrf2 |
Rabbit Polyclonal Anti-Nrf2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Nrf2 Antibody: A synthesized peptide derived from human Nrf2 |
Rabbit Polyclonal Anti-NFE2L2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NFE2L2 antibody: synthetic peptide directed towards the C terminal of human NFE2L2. Synthetic peptide located within the following region: KEKGENDKSLHLLKKQLSTLYLEVFSMLRDEDGKPYSPSEYSLQQTRDGN |
Rabbit Polyclonal Anti-NFE2L2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-NFE2L2 antibody is: synthetic peptide directed towards the C-terminal region of Human NFE2L2. Synthetic peptide located within the following region: VSDLSLCKAFNQNHPESTAEFNDSDSGISLNTSPSVASPEHSVESSSYGD |
Rabbit Polyclonal Anti-Nfe2l2 Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Nfe2l2 antibody is: synthetic peptide directed towards the N-terminal region of Rat Nfe2l2. Synthetic peptide located within the following region: DLIDILWRQDIDLGVSREVFDFSQRQKDYELEKQKKLEKERQEQLQKEQE |
Anti-NFE2L2 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human nuclear factor (erythroid-derived 2)-like 2 |
Active filters
Target Symbol
- NFE2L2
Reactivities
- Human
Antibody Hosts
- Rabbit
Isotypes
- IgG
Families
- Transcription Factors