Germany
Japan
United Kingdom
China
Rabbit anti-POU2F1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human POU2F1 |
Antibodies
View as table Download
Rabbit Polyclonal Anti-OCT1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OCT1 Antibody: A synthesized peptide derived from human 41183 |
Oct-1 (POU2F1) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
Rabbit polyclonal anti-Oct-1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 727 of human Oct-1 |
Rabbit Polyclonal Anti-POU2F1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-POU2F1 antibody: synthetic peptide directed towards the N terminal of human POU2F1. Synthetic peptide located within the following region: AISTAQAQAFLGHLHQVQLAGTSLQAAAQSLNVQSKSNEESGDSQQPSQP |
Rabbit Polyclonal Anti-POU2F1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-POU2F1 Antibody: synthetic peptide directed towards the N terminal of human POU2F1. Synthetic peptide located within the following region: MADGGAASQDESSAAAAAAADSRMNNPSETSKPSMESGDGNTGTQTNGLD |
Anti-POU2F1 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 1-290 amino acids of human POU class 2 homeobox 1 |
Active filters
Target Symbol
- POU2F1
Antibody Hosts
- Rabbit
Families
- Transcription Factors